C7orf59 (LAMTOR4) (NM_001008395) Human Mass Spec Standard

CAT#: PH309099

C7orf59 MS Standard C13 and N15-labeled recombinant protein (NP_001008396)

Product Images

Coomassie blue staining of purified LAMTOR4 protein (Cat# TP309099). The protein was produced from HEK293T cells transfected with LAMTOR4 cDNA clone (Cat# RC209099) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209099
• Predicted MW: 10.7 kDa
• Protein Sequence:
  Sequence Link

  >RC209099 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTSALTQGLERIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTACGFRLHRGMNVPFKRLSVVF
  GEHTLLVTVSGQRVFVVKRQNRGREPIDV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001008396
• RefSeq Size: 613
• RefSeq ORF: 297
• Synonyms: C7orf59
• Locus ID: 389541
• UniProt ID: Q0VGL1
• Cytogenetics: 7q22.1
• Summary: As part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator functions as a guanine nucleotide exchange factor activating the small GTPases Rag. Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated.[UniProtKB/Swiss-Prot Function]