HOXC9 (NM_006897) Human Mass Spec Standard

CAT#: PH308833

HOXC9 MS Standard C13 and N15-labeled recombinant protein (NP_008828)

Product Images

Coomassie blue staining of purified HOXC9 protein (Cat# TP308833). The protein was produced from HEK293T cells transfected with HOXC9 cDNA clone (Cat# RC208833) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208833
• Predicted MW: 29.2 kDa
• Protein Sequence:
  Sequence Link

  >RC208833 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSATGPISNYYVDSLISHDNEDLLASRFPATGAHPAAARPSGLVPDCSDFPSCSFAPKPAVFSTSWAPVP
  SQSSVVYHPYGPQPHLGADTRYMRTWLEPLSGAVSFPSFPAGGRHYALKPDAYPGRRADCGPGEGRSYPD
  YMYGSPGELRDRAPQTLPSPEADALAGSKHKEEKADLDPSNPVANWIHARSTRKKRCPYTKYQTLELEKE
  FLFNMYLTRDRRYEVARVLNLTERQVKIWFQNRRMKMKKMNKEKTDKEQS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_008828
• RefSeq Size: 1640
• RefSeq ORF: 780
• Synonyms: HOX3; HOX3B
• Locus ID: 3225
• UniProt ID: P31274, A0A024RAZ6
• Cytogenetics: 12q13.13
• Summary: This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. [provided by RefSeq, Jul 2008]
• Protein Families: Transcription Factors