Carboxypeptidase H (CPE) (NM_001873) Human Mass Spec Standard

SKU
PH308791
CPE MS Standard C13 and N15-labeled recombinant protein (NP_001864)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208791]
Predicted MW 53.15 kDa
Protein Sequence
Protein Sequence
>RC208791 representing NM_001873
Red=Cloning site Green=Tags(s)

MAGRGGSALLALCGALAACGWLLGAEAQEPGAPAAGMRRRRRLQQEDGISFEYHRYPELREALVSVWLQC
TAISRIYTVGRSFEGRELLVIELSDNPGVHEPGEPEFKYIGNMHGNEAVGRELLIFLAQYLCNEYQKGNE
TIVNLIHSTRIHIMPSLNPDGFEKAASQPGELKDWFVGRSNAQGIDLNRNFPDLDRIVYVNEKEGGPNNH
LLKNMKKIVDQNTKLAPETKAVIHWIMDIPFVLSANLHGGDLVANYPYDETRSGSAHEYSSSPDDAIFQS
LARAYSSFNPAMSDPNRPPCRKNDDDSSFVDGTTNGGAWYSVPGGMQDFNYLSSNCFEITVELSCEKFPP
EETLKTYWEDNKNSLISYLEQIHRGVKGFVRDLQGNPIANATISVEGIDHDVTSAKDGDYWRLLIPGNYK
LTASAPGYLAITKKVAVPYSPAAGVDFELESFSERKEEEKEELMEWWKMMSETLNF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001864
RefSeq Size 2443
RefSeq ORF 1428
Synonyms CPH; IDDHH
Locus ID 1363
UniProt ID P16870
Cytogenetics 4q32.3
Summary This gene encodes a member of the M14 family of metallocarboxypeptidases. The encoded preproprotein is proteolytically processed to generate the mature peptidase. This peripheral membrane protein cleaves C-terminal amino acid residues and is involved in the biosynthesis of peptide hormones and neurotransmitters, including insulin. This protein may also function independently of its peptidase activity, as a neurotrophic factor that promotes neuronal survival, and as a sorting receptor that binds to regulated secretory pathway proteins, including prohormones. Mutations in this gene are implicated in type 2 diabetes. [provided by RefSeq, Nov 2015]
Protein Families Druggable Genome, Protease, Secreted Protein
Protein Pathways Type I diabetes mellitus
Write Your Own Review
You're reviewing:Carboxypeptidase H (CPE) (NM_001873) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC419701 CPE HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419701 Transient overexpression lysate of carboxypeptidase E (CPE) 100 ug
$436.00
TP308791 Recombinant protein of human carboxypeptidase E (CPE), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP721092 Purified recombinant protein of Human carboxypeptidase E (CPE) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.