RAC1 (NM_006908) Human Mass Spec Standard
CAT#: PH308711
RAC1 MS Standard C13 and N15-labeled recombinant protein (NP_008839)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208711 |
Predicted MW | 21.5 kDa |
Protein Sequence |
>RC208711 protein sequence
Red=Cloning site Green=Tags(s) MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPL SYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYP QGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_008839 |
RefSeq Size | 2341 |
RefSeq ORF | 576 |
Synonyms | MIG5; MRD48; p21-Rac1; Rac-1; TC-25 |
Locus ID | 5879 |
UniProt ID | P63000, A4D2P1 |
Cytogenetics | 7p22.1 |
Summary | The protein encoded by this gene is a GTPase which belongs to the RAS superfamily of small GTP-binding proteins. Members of this superfamily appear to regulate a diverse array of cellular events, including the control of cell growth, cytoskeletal reorganization, and the activation of protein kinases. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2009] |
Protein Families | Druggable Genome |
Protein Pathways | Adherens junction, Amyotrophic lateral sclerosis (ALS), Axon guidance, B cell receptor signaling pathway, Chemokine signaling pathway, Colorectal cancer, Epithelial cell signaling in Helicobacter pylori infection, Fc epsilon RI signaling pathway, Fc gamma R-mediated phagocytosis, Focal adhesion, Leukocyte transendothelial migration, MAPK signaling pathway, Natural killer cell mediated cytotoxicity, Neurotrophin signaling pathway, Pancreatic cancer, Pathways in cancer, Regulation of actin cytoskeleton, Renal cell carcinoma, Toll-like receptor signaling pathway, VEGF signaling pathway, Viral myocarditis, Wnt signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412906 | RAC1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC416329 | RAC1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC429589 | RAC1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY412906 | Transient overexpression lysate of ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1) (RAC1), transcript variant Rac1b |
USD 436.00 |
|
LY416329 | Transient overexpression lysate of ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1) (RAC1), transcript variant Rac1 |
USD 436.00 |
|
PH324262 | RAC1 MS Standard C13 and N15-labeled recombinant protein (NP_061485) |
USD 3,255.00 |
|
TP308711 | Recombinant protein of human ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1) (RAC1), transcript variant Rac1, 20 µg |
USD 867.00 |
|
TP324262 | Recombinant protein of human ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1) (RAC1), transcript variant Rac1b, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review