MYG1 (NM_021640) Human Mass Spec Standard

CAT#: PH308702

C12orf10 MS Standard C13 and N15-labeled recombinant protein (NP_067653)

Product Images

Coomassie blue staining of purified C12orf10 protein (Cat# TP308702). The protein was produced from HEK293T cells transfected with C12orf10 cDNA clone (Cat# RC208702) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208702
• Predicted MW: 42.5 kDa
• Protein Sequence:
  Sequence Link

  >RC208702 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGHRFLRGLLTLLLPPPPLYTRHRMLGPESVPPPKRSRSKLMAPPRIGTHNGTFHCDEALACALLRLLPE
  YRDAEIVRTRDPEKLASCDIVVDVGGEYDPRRHRYDHHQRSFTETMSSLSPGKPWQTKLSSAGLIYLHFG
  HKLLAQLLGTSEEDSMVGTLYDKMYENFVEEVDAVDNGISQWAEGEPRYALTTTLSARVARLNPTWNHPD
  QDTEAGFKRAMDLVQEEFLQRLDFYQHSWLPARALVEEALAQRFQVDPSGEIVELAKGACPWKEHLYHLE
  SGLSPPVAIFFVIYTDQAGQWRIQCVPKEPHSFQSRLPLPEPWRGLRDEALDQVSGIPGCIFVHASGFIG
  GHRTREGALSMARATLAQRSYLPQIS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_067653
• RefSeq Size: 1215
• RefSeq ORF: 1128
• Synonyms: C12orf10; Gamm1; MST024; MSTP024; MYG
• Locus ID: 60314
• UniProt ID: Q86UA3
• Cytogenetics: 12q13.13
• Summary: 3'-5' RNA exonuclease which cleaves in situ on specific transcripts in both nucleus and mitochondrion. Involved in regulating spatially segregated organellar RNA processing, acts as a coordinator of nucleo-mitochondrial crosstalk (PubMed:31081026). In nucleolus, processes pre-ribosomal RNA involved in ribosome assembly and alters cytoplasmic translation. In mitochondrial matrix, processes 3'-termini of the mito-ribosomal and messenger RNAs and controls translation of mitochondrial proteins (Probable).[UniProtKB/Swiss-Prot Function]