Cathepsin Z (CTSZ) (NM_001336) Human Mass Spec Standard
CAT#: PH308341
CTSZ MS Standard C13 and N15-labeled recombinant protein (NP_001327)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208341 |
Predicted MW | 33.9 kDa |
Protein Sequence |
>RC208341 protein sequence
Red=Cloning site Green=Tags(s) MARRGPGWRPLLLLVLLAGAAQGGLYFRRGQTCYRPLRGDGLAPLGRSTYPRPHEYLSPADLPKSWDWRN VDGVNYASITRNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSVQNVIDCGNAGSCEGGNDLSV WDYAHQHGIPDETCNNYQAKDQECDKFNQCGTCNEFKECHAIRNYTLWRVGDYGSLSGREKMMAEIYANG PISCGIMATERLANYTGGIYAEYQDTTYINHVVSVAGWGISDGTEYWIVRNSWGEPWGERGWLRIVTSTY KDGKGARYNLAIEEHCTFGDPIV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001327 |
RefSeq Size | 1517 |
RefSeq ORF | 909 |
Synonyms | CTSX |
Locus ID | 1522 |
UniProt ID | Q9UBR2 |
Cytogenetics | 20q13.32 |
Summary | The protein encoded by this gene is a lysosomal cysteine proteinase and member of the peptidase C1 family. It exhibits both carboxy-monopeptidase and carboxy-dipeptidase activities. The encoded protein has also been known as cathepsin X and cathepsin P. This gene is expressed ubiquitously in cancer cell lines and primary tumors and, like other members of this family, may be involved in tumorigenesis. [provided by RefSeq, Oct 2008] |
Protein Families | Druggable Genome, Protease |
Protein Pathways | Lysosome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400531 | CTSZ HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY400531 | Transient overexpression lysate of cathepsin Z (CTSZ) |
USD 436.00 |
|
TP308341 | Recombinant protein of human cathepsin Z (CTSZ), 20 µg |
USD 867.00 |
|
TP720370 | Recombinant protein of human cathepsin Z (CTSZ) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review