CAMK1D (NM_153498) Human Mass Spec Standard

SKU
PH307736
CAMK1D MS Standard C13 and N15-labeled recombinant protein (NP_705718)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC207736]
Predicted MW 42.9 kDa
Protein Sequence
Protein Sequence
>RC207736 protein sequence
Red=Cloning site Green=Tags(s)

MARENGESSSSWKKQAEDIKKIFEFKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKALKGKESSIENEI
AVLRKIKHENIVALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKDASTLIRQVLDAVYYLHRMGI
VHRDLKPENLLYYSQDEESKIMISDFGLSKMEGKGDVMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVI
AYILLCGYPPFYDENDSKLFEQILKAEYEFDSPYWDDISDSAKDFIRNLMEKDPNKRYTCEQAARHPWIA
GDTALNKNIHESVSAQIRKNFAKSKWRQAFNATAVVRHMRKLHLGSSLDSSNASVSSSLSLASQKDCLAP
STLCSFISSSSGVSGVGAERRPRPTTVTAVHSGSK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_705718
RefSeq Size 2242
RefSeq ORF 1155
Synonyms CaM-K1; CaMKID; CKLiK
Locus ID 57118
UniProt ID Q8IU85
Cytogenetics 10p13
Summary This gene is a member of the calcium/calmodulin-dependent protein kinase 1 family, a subfamily of the serine/threonine kinases. The encoded protein is a component of the calcium-regulated calmodulin-dependent protein kinase cascade. It has been associated with multiple processes including regulation of granulocyte function, activation of CREB-dependent gene transcription, aldosterone synthesis, differentiation and activation of neutrophil cells, and apoptosis of erythroleukemia cells. Alternatively spliced transcript variants encoding different isoforms of this gene have been described. [provided by RefSeq, Jan 2015]
Protein Families Druggable Genome, Protein Kinase
Write Your Own Review
You're reviewing:CAMK1D (NM_153498) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC407015 CAMK1D HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC412500 CAMK1D HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC429619 CAMK1D HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY407015 Transient overexpression lysate of calcium/calmodulin-dependent protein kinase ID (CAMK1D), transcript variant 2 100 ug
$436.00
LY412500 Transient overexpression lysate of calcium/calmodulin-dependent protein kinase ID (CAMK1D), transcript variant 1 100 ug
$436.00
TP307736 Recombinant protein of human calcium/calmodulin-dependent protein kinase ID (CAMK1D), transcript variant 2, 20 µg 20 ug
$867.00
TP721028 Purified recombinant protein of Human calcium/calmodulin-dependent protein kinase ID (CAMK1D), transcript variant 2 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.