SPZ1 (NM_032567) Human Mass Spec Standard

CAT#: PH307443

SPZ1 MS Standard C13 and N15-labeled recombinant protein (NP_115956)

Product Images

Coomassie blue staining of purified SPZ1 protein (Cat# TP307443). The protein was produced from HEK293T cells transfected with SPZ1 cDNA clone (Cat# RC207443) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207443
• Predicted MW: 49.5 kDa
• Protein Sequence:
  Sequence Link

  >RC207443 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASSAKSAEMPTISKTLNPTPDPHQEYLDPRITIALFEIGSHSPSSWGSLPFLKNSSHQVTEQQTAQKFN
  NLLKEIKDILKNMAGFEEKITEAKELFEETNITEDVSAHKENIRGLDKINEMLSTNLPVSLAPEKEDNEK
  KQEMILETNITEDVSAHKENIRGLDKINEMLSTNLPVSLAPEKEDNEKKQQMIMENQNSENTAQVFARDL
  VNRLEEKKVLNETQQSQEKAKNRLNVQEETMKIRNNMEQLLQEAEHWSKQHTELSKLIKSYQKSQKDISE
  TLGNNGVGFQTQPNNEVSAKHELEEQVKKLSHDTYSLQLMAALLENECQILQQRVEILKELHHQKQGTLQ
  EKPIQINYKQDKKNQKPSEAKKVEMYKQNKQAMKGTFWKKDRSCRSLDVCLNKKACNTQFNIHVARKALR
  GKMRSASSLR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_115956
• RefSeq Size: 1873
• RefSeq ORF: 1290
• Synonyms: CILD38; NYD-TSP1; PPP1R148
• Locus ID: 84654
• UniProt ID: Q9BXG8, A0A140VKA5
• Cytogenetics: 5q14.1
• Summary: This gene encodes a bHLH-zip transcription factor which functions in the mitogen-activate protein kinase (MAPK) signaling pathway. Because of its role in the upregulation of cell proliferation and tumorigenesis, this gene may serve as a target for Ras-induced tumor treatments. [provided by RefSeq, Oct 2011]