Glutathione Peroxidase 7 (GPX7) (NM_015696) Human Mass Spec Standard

CAT#: PH307428

GPX7 MS Standard C13 and N15-labeled recombinant protein (NP_056511)

Product Images

Coomassie blue staining of purified GPX7 protein (Cat# TP307428). The protein was produced from HEK293T cells transfected with GPX7 cDNA clone (Cat# RC207428) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207428
• Predicted MW: 21 kDa
• Protein Sequence:
  Sequence Link

  >RC207428 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVAATVAAAWLLLWAAACAQQEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQL
  QRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEP
  TWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVRKLILLKREDL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_056511
• RefSeq Size: 1246
• RefSeq ORF: 561
• Synonyms: CL683; GPx-7; GPX6; GSHPx-7; NPGPx
• Locus ID: 2882
• UniProt ID: Q96SL4
• Cytogenetics: 1p32.3
• Summary: It protects esophageal epithelia from hydrogen peroxide-induced oxidative stress. It suppresses acidic bile acid-induced reactive oxigen species (ROS) and protects against oxidative DNA damage and double-strand breaks.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Arachidonic acid metabolism, Glutathione metabolism