Cytochrome p450 2J2 (CYP2J2) (NM_000775) Human Mass Spec Standard

CAT#: PH307417

CYP2J2 MS Standard C13 and N15-labeled recombinant protein (NP_000766)

Product Images

Coomassie blue staining of purified CYP2J2 protein (Cat# TP307417). The protein was produced from HEK293T cells transfected with CYP2J2 cDNA clone (Cat# RC207417) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207417
• Predicted MW: 57.6 kDa
• Protein Sequence:
  Sequence Link

  >RC207417 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLAAMGSLAAALWAVVHPRTLLLGTVAFLLAADFLKRRRPKNYPPGPWRLPFLGNFFLVDFEQSHLEVQL
  FVKKYGNLFSLELGDISAVLITGLPLIKEALIHMDQNFGNRPVTPMREHIFKKNGLIMSSGQAWKEQRRF
  TLTALRNFGLGKKSLEERIQEEAQHLTEAIKEENGQPFDPHFKINNAVSNIICSITFGERFEYQDSWFQQ
  LLKLLDEVTYLEASKTCQLYNVFPWIMKFLPGPHQTLFSNWKKLKLFVSHMIDKHRKDWNPAETRDFIDA
  YLKEMSKHTGNPTSSFHEENLICSTLDLFFAGTETTSTTLRWALLYMALYPEIQEKVQAEIDRVIGQGQQ
  PSTAARESMPYTNAVIHEVQRMGNIIPLNVPREVTVDTTLAGYHLPKGTMILTNLTALHRDPTEWATPDT
  FNPDHFLENGQFKKREAFMPFSIGKRACLGEQLARTELFIFFTSLMQKFTFRPPNNEKLSLKFRMGITIS
  PVSHRLCAVPQV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000766
• RefSeq Size: 1876
• RefSeq ORF: 1506
• Synonyms: CPJ2; CYPIIJ2
• Locus ID: 1573
• UniProt ID: P51589
• Cytogenetics: 1p32.1
• Summary: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is thought to be the predominant enzyme responsible for epoxidation of endogenous arachidonic acid in cardiac tissue. Multiple transcript variants have been found for this gene. [provided by RefSeq, Jan 2016]
• Protein Families: Druggable Genome, P450, Transmembrane
• Protein Pathways: Arachidonic acid metabolism, Linoleic acid metabolism, Metabolic pathways