PPM1K (NM_152542) Human Mass Spec Standard

CAT#: PH307144

PPM1K MS Standard C13 and N15-labeled recombinant protein (NP_689755)

Product Images

Coomassie blue staining of purified PPM1K protein (Cat# TP307144). The protein was produced from HEK293T cells transfected with PPM1K cDNA clone (Cat# RC207144) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207144
• Predicted MW: 41 kDa
• Protein Sequence:
  Sequence Link

  >RC207144 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSTAALITLVRSGGNQVRRRVLLSSRLLQDDRRVTPTCHSSTSEPRCSRFDPDGSGSPATWDNFGIWDNR
  IDEPILLPPSIKYGKPIPKISLEKVGCASQIGKRKENEDRFDFAQLTDEVLYFAVYDGHGGPAAADFCHT
  HMEKCIMDLLPKEKNLETLLTLAFLEIDKAFSSHARLSADATLLTSGTTATVALLRDGIELVVASVGDSR
  AILCRKGKPMKLTIDHTPERKDEKERIKKCGGFVAWNSLGQPHVNGRLAMTRSIGDLDLKTSGVIAEPET
  KRIKLHHADDSFLVLTTDGINFMVNSQEICDFVNQCHDPNEAAHAVTEQAIQYGTEDNSTAVVVPFGAWG
  KYKNSEINFSFSRSFASSGRWA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_689755
• RefSeq Size: 6590
• RefSeq ORF: 1116
• Synonyms: BDP; MSUDMV; PP2Ckappa; PP2Cm; PTMP; UG0882E07
• Locus ID: 152926
• UniProt ID: Q8N3J5
• Cytogenetics: 4q22.1
• Summary: This gene encodes a member of the PPM family of Mn2+/Mg2+-dependent protein phosphatases. The encoded protein, essential for cell survival and development, is targeted to the mitochondria where it plays a key role in regulation of the mitochondrial permeability transition pore. [provided by RefSeq, Sep 2012]
• Protein Families: Phosphatase