MEK3 (MAP2K3) (NM_145109) Human Mass Spec Standard

SKU
PH307115
MAP2K3 MS Standard C13 and N15-labeled recombinant protein (NP_659731)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC207115]
Predicted MW 39.3 kDa
Protein Sequence
Protein Sequence
>RC207115 protein sequence
Red=Cloning site Green=Tags(s)

MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVEADDLVTISEL
GRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICM
ELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFG
ISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQ
VVEEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_659731
RefSeq Size 2319
RefSeq ORF 1041
Synonyms MAPKK3; MEK3; MKK3; PRKMK3; SAPKK-2; SAPKK2
Locus ID 5606
UniProt ID P46734
Cytogenetics 17p11.2
Summary The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase is activated by mitogenic and environmental stress, and participates in the MAP kinase-mediated signaling cascade. It phosphorylates and thus activates MAPK14/p38-MAPK. This kinase can be activated by insulin, and is necessary for the expression of glucose transporter. Expression of RAS oncogene is found to result in the accumulation of the active form of this kinase, which thus leads to the constitutive activation of MAPK14, and confers oncogenic transformation of primary cells. The inhibition of this kinase is involved in the pathogenesis of Yersina pseudotuberculosis. Multiple alternatively spliced transcript variants that encode distinct isoforms have been reported for this gene. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Protein Kinase, Transcription Factors
Protein Pathways Amyotrophic lateral sclerosis (ALS), Fc epsilon RI signaling pathway, GnRH signaling pathway, MAPK signaling pathway, Toll-like receptor signaling pathway
Write Your Own Review
You're reviewing:MEK3 (MAP2K3) (NM_145109) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH318101 MAP2K3 MS Standard C13 and N15-labeled recombinant protein (NP_002747) 10 ug
$3,255.00
LC403425 MAP2K3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403425 Transient overexpression lysate of mitogen-activated protein kinase kinase 3 (MAP2K3), transcript variant B 100 ug
$436.00
TP307115 Recombinant protein of human mitogen-activated protein kinase kinase 3 (MAP2K3), transcript variant B, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP318101 Recombinant protein of human mitogen-activated protein kinase kinase 3 (MAP2K3), transcript variant A, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.