KLF4 (NM_004235) Human Mass Spec Standard

SKU
PH306691
KLF4 MS Standard C13 and N15-labeled recombinant protein (NP_004226)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206691]
Predicted MW 49.9 kDa
Protein Sequence
Protein Sequence
>RC206691 representing NM_004235
Red=Cloning site Green=Tags(s)

MAVSDALLPSFSTFASGPAGREKTLRQAGAPNNRWREELSHMKRLPPVLPGRPYDLAAATVATDLESGGA
GAACGGSNLAPLPRRETEEFNDLLDLDFILSNSLTHPPESVAATVSSSASASSSSSPSSSGPASAPSTCS
FTYPIRAGNDPGVAPGGTGGGLLYGRESAPPPTAPFNLADINDVSPSGGFVAELLRPELDPVYIPPQQPQ
PPGGGLMGKFVLKASLSAPGSEYGSPSVISVSKGSPDGSHPVVVAPYNGGPPRTCPKIKQEAVSSCTHLG
AGPPLSNGHRPAAHDFPLGRQLPSRTTPTLGLEEVLSSRDCHPALPLPPGFHPHPGPNYPSFLPDQMQPQ
VPPLHYQELMPPGSCMPEEPKPKRGRRSWPRKRTATHTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCD
WDGCGWKFARSDELTRHYRKHTGHRPFQCQKCDRAFSRSDHLALHMKRHF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004226
RefSeq Size 2639
RefSeq ORF 1410
Synonyms EZF; GKLF
Locus ID 9314
UniProt ID O43474
Cytogenetics 9q31.2
Summary This gene encodes a protein that belongs to the Kruppel family of transcription factors. The encoded zinc finger protein is required for normal development of the barrier function of skin. The encoded protein is thought to control the G1-to-S transition of the cell cycle following DNA damage by mediating the tumor suppressor gene p53. Mice lacking this gene have a normal appearance but lose weight rapidly, and die shortly after birth due to fluid evaporation resulting from compromised epidermal barrier function. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Sep 2015]
Protein Families Adult stem cells, Embryonic stem cells, ES Cell Differentiation/IPS, Induced pluripotent stem cells, Transcription Factors
Write Your Own Review
You're reviewing:KLF4 (NM_004235) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401356 KLF4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC432255 KLF4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401356 Transient overexpression lysate of Kruppel-like factor 4 (gut) (KLF4) 100 ug
$436.00
LY432255 Transient overexpression lysate of Kruppel-like factor 4 (gut) (KLF4) 100 ug
$436.00
TP306691 Recombinant protein of human Kruppel-like factor 4 (gut) (KLF4), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.