Myosin Light Chain 2 (MYL2) (NM_000432) Human Mass Spec Standard
CAT#: PH305932
MYL2 MS Standard C13 and N15-labeled recombinant protein (NP_000423)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205932 |
Predicted MW | 18.8 kDa |
Protein Sequence |
>RC205932 protein sequence
Red=Cloning site Green=Tags(s) MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMI KEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFA AFPPDVTGNLDYKNLVHIITHGEEKD myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_000423 |
RefSeq Size | 855 |
RefSeq ORF | 498 |
Synonyms | CMH10; MLC-2s/v; MLC2 |
Locus ID | 4633 |
UniProt ID | P10916, Q6IB42 |
Cytogenetics | 12q24.11 |
Summary | Thus gene encodes the regulatory light chain associated with cardiac myosin beta (or slow) heavy chain. Ca+ triggers the phosphorylation of regulatory light chain that in turn triggers contraction. Mutations in this gene are associated with mid-left ventricular chamber type hypertrophic cardiomyopathy. [provided by RefSeq, Jul 2008] |
Protein Pathways | Cardiac muscle contraction, Dilated cardiomyopathy, Focal adhesion, Hypertrophic cardiomyopathy (HCM), Leukocyte transendothelial migration, Regulation of actin cytoskeleton, Tight junction |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400153 | MYL2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY400153 | Transient overexpression lysate of myosin, light chain 2, regulatory, cardiac, slow (MYL2) |
USD 436.00 |
|
TP305932 | Recombinant protein of human myosin, light chain 2, regulatory, cardiac, slow (MYL2), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review