ZC3H10 (NM_032786) Human Mass Spec Standard

CAT#: PH305804

ZC3H10 MS Standard C13 and N15-labeled recombinant protein (NP_116175)

Product Images

Coomassie blue staining of purified ZC3H10 protein (Cat# TP305804). The protein was produced from HEK293T cells transfected with ZC3H10 cDNA clone (Cat# RC205804) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205804
• Predicted MW: 46.1 kDa
• Protein Sequence:
  Sequence Link

  >RC205804 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPDRDSYANGTGSSGGGPGGGGSEEASGAGVGSGGASSDAICRDFLRNVCKRGKRCRYRHPDMSEVSNLG
  VSKNEFIFCHDFQNKECSRPNCRFIHGSKEDEDGYKKTGELPPRLRQKVAAGLGLSPADLPNGKEEVPIC
  RDFLKGDCQRGAKCKFRHLQRDFEFDARGGGGTGGGSTGSVLPGRRHDLYDIYDLPDRGFEDHEPGPKRR
  RGGCCPPDGPHFESYEYSLAPPRGVECRLLEEENAMLRKRVEELKKQVSNLLATNEVLLEQNAQFRNQAK
  VITLSSTAPATEQTLAPTVGTVATFNHGIAQTHTTLSSQALQPRPVSQQELVAPAGAPAAPPTNAAPPAA
  PPPPPPHLTPEITPLSAALAQTIAQGMAPPPVSMAPVAVSVAPVAPVAVSMAQPLAGITMSHTTTPMVTY
  PIASQSMRITAMPH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_116175
• RefSeq Size: 2121
• RefSeq ORF: 1302
• Synonyms: ZC3HDC10
• Locus ID: 84872
• UniProt ID: Q96K80
• Cytogenetics: 12q13.2
• Summary: Specific regulator of miRNA biogenesis. Binds, via the C3H1-type zinc finger domains, to the binding motif 5'-GCAGCGC-3' on microRNA pri-MIR143 and negatively regulates the processing to mature microRNA.[UniProtKB/Swiss-Prot Function]