TrkB (NTRK2) (NM_001007097) Human Mass Spec Standard

CAT#: PH305129

NTRK2 MS Standard C13 and N15-labeled recombinant protein (NP_001007098)

Product Images

Coomassie blue staining of purified NTRK2 protein (Cat# TP305129). The protein was produced from HEK293T cells transfected with NTRK2 cDNA clone (Cat# RC205129) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205129
• Predicted MW: 53.1 kDa
• Protein Sequence:
  Sequence Link

  >RC205129 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITE
  IFIANQKRLEIINEDDVEAYVGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDL
  SELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNESSKNIPLANLQIPNCGLPSANLAAPNLTVEE
  GKSITLSCSVAGDPVPNMYWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVN
  LTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDN
  PTHMNNGDYTLIAKNEYGKDEKQISAHFMGWPGIDDGANPNYPDVIYEDYGTAANDIGDTTNRSNEIPST
  DVTDKTGREHLSVYAVVVIASVVGFCLLVMLFLLKLARHSKFGMKGFVLFHKIPLDG
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001007098
• RefSeq Size: 7157
• RefSeq ORF: 1431
• Synonyms: DEE58; EIEE58; GP145-TrkB; OBHD; trk-B; TRKB
• Locus ID: 4915
• UniProt ID: Q16620, Q5VWE5
• Cytogenetics: 9q21.33
• Summary: This gene encodes a member of the neurotrophic tyrosine receptor kinase (NTRK) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. Signalling through this kinase leads to cell differentiation. Mutations in this gene have been associated with obesity and mood disorders. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2014]
• Protein Families: Druggable Genome, Protein Kinase, Transmembrane
• Protein Pathways: MAPK signaling pathway, Neurotrophin signaling pathway