P2Y12 (P2RY12) (NM_022788) Human Mass Spec Standard
CAT#: PH305005
P2RY12 MS Standard C13 and N15-labeled recombinant protein (NP_073625)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205005 |
Predicted MW | 39.4 kDa |
Protein Sequence |
>RC205005 protein sequence
Red=Cloning site Green=Tags(s) MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFIIFLKNTVISD LLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITIDRYQKTTRPFKTSNPKNLLG AKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYT LITKELYRSYVRTRGVGKVPRKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVK ESTLWLTSLNACLDPFIYFFLCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_073625 |
RefSeq Size | 2318 |
RefSeq ORF | 1026 |
Synonyms | ADPG-R; BDPLT8; HORK3; P2T(AC); P2Y(12)R; P2Y(AC); P2Y(ADP); P2Y(cyc); P2Y12; SP1999 |
Locus ID | 64805 |
UniProt ID | Q9H244, A8K7T1 |
Cytogenetics | 3q25.1 |
Summary | The product of this gene belongs to the family of G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and uridine nucleotides. This receptor is involved in platelet aggregation, and is a potential target for the treatment of thromboembolisms and other clotting disorders. Mutations in this gene are implicated in bleeding disorder, platelet type 8 (BDPLT8). Alternative splicing results in multiple transcript variants of this gene. [provided by RefSeq, Jul 2013] |
Protein Families | Druggable Genome, GPCR, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402949 | P2RY12 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC403587 | P2RY12 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY402949 | Transient overexpression lysate of purinergic receptor P2Y, G-protein coupled, 12 (P2RY12), transcript variant 1 |
USD 436.00 |
|
LY403587 | Transient overexpression lysate of purinergic receptor P2Y, G-protein coupled, 12 (P2RY12), transcript variant 2 |
USD 436.00 |
|
TP305005 | Recombinant protein of human purinergic receptor P2Y, G-protein coupled, 12 (P2RY12), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review