SLIRP (NM_031210) Human Mass Spec Standard

CAT#: PH305002

C14orf156 MS Standard C13 and N15-labeled recombinant protein (NP_112487)

Product Images

Coomassie blue staining of purified SLIRP protein (Cat# TP305002). The protein was produced from HEK293T cells transfected with SLIRP cDNA clone (Cat# RC205002) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205002
• Predicted MW: 12.3 kDa
• Protein Sequence:
  Sequence Link

  >RC205002 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAASAARGAAALRRSINQPVAFVRRIPWTAASSQLKEHFAQFGHVRRCILPFDKETGFHRGLGWVQFSSE
  EGLRNALQQENHIIDGVKVQVHTRRPKLPQTSDDEKKDF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_112487
• RefSeq Size: 420
• RefSeq ORF: 327
• Synonyms: C14orf156; DC50; PD04872
• Locus ID: 81892
• UniProt ID: Q9GZT3
• Cytogenetics: 14q24.3
• Summary: Steroid receptor RNA activator (SRA, or SRA1; MIM 603819) is a complex RNA molecule containing multiple stable stem-loop structures that functions in coactivation of nuclear receptors. SLIRP interacts with stem-loop structure-7 of SRA (STR7) and modulates nuclear receptor transactivation (Hatchell et al., 2006 [PubMed 16762838]).[supplied by OMIM, Mar 2008]