ACN9 (SDHAF3) (NM_020186) Human Mass Spec Standard

CAT#: PH304626

ACN9 MS Standard C13 and N15-labeled recombinant protein (NP_064571)

Product Images

Coomassie blue staining of purified SDHAF3 protein (Cat# TP304626). The protein was produced from HEK293T cells transfected with SDHAF3 cDNA clone (Cat# RC204626) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204626
• Predicted MW: 14.7 kDa
• Protein Sequence:
  Sequence Link

  >RC204626 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPGRHVSRVRALYKRVLQLHRVLPPDLKSLGDQYVKDEFRRHKTVGSDEAQRFLQEWEVYATALLQQANE
  NRQNSTGKACFGTFLPEEKLNDFRDEQIGQLQELMQEATKPNRQFSISESMKPKF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_064571
• RefSeq Size: 2068
• RefSeq ORF: 375
• Synonyms: ACN9; DC11; LYRM10; Sdh7
• Locus ID: 57001
• UniProt ID: Q9NRP4
• Cytogenetics: 7q21.3
• Summary: Plays an essential role in the assembly of succinate dehydrogenase (SDH), an enzyme complex (also referred to as respiratory complex II) that is a component of both the tricarboxylic acid (TCA) cycle and the mitochondrial electron transport chain, and which couples the oxidation of succinate to fumarate with the reduction of ubiquinone (coenzyme Q) to ubiquinol. Promotes maturation of the iron-sulfur protein subunit SDHB of the SDH catalytic dimer, protecting it from the deleterious effects of oxidants. May act together with SDHAF1.[UniProtKB/Swiss-Prot Function]