Tropomyosin 2 (TPM2) (NM_213674) Human Mass Spec Standard

CAT#: PH304007

TPM2 MS Standard C13 and N15-labeled recombinant protein (NP_998839)

Product Images

Coomassie blue staining of purified TPM2 protein (Cat# TP304007). The protein was produced from HEK293T cells transfected with TPM2 cDNA clone (Cat# RC204007) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204007
• Predicted MW: 33 kDa
• Protein Sequence:
  Sequence Link

  >RC204007 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDAIKKKMQMLKLDKENAIDRAEQAEADKKQAEDRCKQLEEEQQALQKKLKGTEDEVEKYSESVKEAQEK
  LEQAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEK
  MELQEMQLKEAKHIAEDSDRKYEEVARKLVILEGELERSEERAEVAESRARQLEEELRTMDQALKSLMAS
  EEEYSTKEDKYEEEIKLLEEKLKEAETRAEFAERSVAKLEKTIDDLEETLASAKEENVEIHQTLDQTLLE
  LNNL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_998839
• RefSeq Size: 1182
• RefSeq ORF: 852
• Synonyms: AMCD1; DA1; DA2B; DA2B4; HEL-S-273; NEM4; TMSB
• Locus ID: 7169
• UniProt ID: P07951, V9HW25
• Cytogenetics: 9p13.3
• Summary: This gene encodes beta-tropomyosin, a member of the actin filament binding protein family, and mainly expressed in slow, type 1 muscle fibers. Mutations in this gene can alter the expression of other sarcomeric tropomyosin proteins, and cause cap disease, nemaline myopathy and distal arthrogryposis syndromes. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Mar 2009]
• Protein Pathways: Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM)