UCHL5IP (HAUS7) (NM_017518) Human Mass Spec Standard

CAT#: PH303737

HAUS7 MS Standard C13 and N15-labeled recombinant protein (NP_059988)

Product Images

Coomassie blue staining of purified HAUS7 protein (Cat# TP303737). The protein was produced from HEK293T cells transfected with HAUS7 cDNA clone (Cat# RC203737) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203737
• Predicted MW: 40.8 kDa
• Protein Sequence:
  Sequence Link

  >RC203737 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGGARLGARNMAGQDAGCGRGGDDYSEDEGDSSVSRAAVEVFGKLKDLNCPFLEGLYITEPKTIQELLCS
  PSEYRLEILEWMCTRVWPSLQDRFSSLKGVPTEVKIQEMTKLGHELMLCAPDDQELLKGCACAQKQLHFM
  DQLLDTIRSLTIGCSSCSSLMEHFEDTREKNEALLGELFSSPHLQMLLNPECDPWPLDMQPLLNKQSDDW
  QWASASAKSEEEEKLAELARQLQESAAKLHALRTEYFAQHEQGAAAGAADISTLDQKLRLVTSDFHQLIL
  AFLQVYDDELGECCQRPGPDLHPCGPIIQATHQNLTSYSQLLQVVMAVADTSAKAVETVKKQQGEQICWG
  GSSSVMSLATKMNELMEK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_059988
• RefSeq Size: 1378
• RefSeq ORF: 1104
• Synonyms: UCHL5IP; UIP1
• Locus ID: 55559
• UniProt ID: Q99871
• Cytogenetics: Xq28
• Summary: This gene encodes a subunit of the augmin complex, which regulates centrosome and mitotic spindle integrity, and is necessary for the completion of cytokinesis. The encoded protein was identified by interaction with ubiquitin C-terminal hydrolase 37. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2012]