ATP6V0C (NM_001694) Human Mass Spec Standard
CAT#: PH303652
ATP6V0C MS Standard C13 and N15-labeled recombinant protein (NP_001685)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203652 |
Predicted MW | 15.7 kDa |
Protein Sequence |
>RC203652 protein sequence
Red=Cloning site Green=Tags(s) MSESKSGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPEQIMKSIIPVVMAGIIAIYGL VVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEV LGLYGLIVALILSTK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001685 |
RefSeq Size | 1180 |
RefSeq ORF | 465 |
Synonyms | ATP6C; ATP6L; ATPL; VATL; Vma3; VPPC |
Locus ID | 527 |
UniProt ID | P27449 |
Cytogenetics | 16p13.3 |
Summary | This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c", and d. This gene encodes the V0 subunit c. Alternative splicing results in transcript variants. Pseudogenes have been identified on chromosomes 6 and 17. [provided by RefSeq, Nov 2010] |
Protein Families | Transmembrane |
Protein Pathways | Epithelial cell signaling in Helicobacter pylori infection, Lysosome, Metabolic pathways, Oxidative phosphorylation, Vibrio cholerae infection |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419794 | ATP6V0C HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY419794 | Transient overexpression lysate of ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c (ATP6V0C) |
USD 436.00 |
|
TP303652 | Recombinant protein of human ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c (ATP6V0C), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review