SMAP (C11orf58) (NM_014267) Human Mass Spec Standard

CAT#: PH303329

C11orf58 MS Standard C13 and N15-labeled recombinant protein (NP_055082)

Product Images

Coomassie blue staining of purified C11orf58 protein (Cat# TP303329). The protein was produced from HEK293T cells transfected with C11orf58 cDNA clone (Cat# RC203329) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203329
• Predicted MW: 20.3 kDa
• Protein Sequence:
  Sequence Link

  >RC203329 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSAARESHPHGVKRSASPDDDLGSSNWEAADLGNEERKQKFLRLMGAGKKEHTGRLVIGDHKSTSHFRTG
  EEDKKINEELESQYQQSMDSKLSGRYRRHCGLGFSEVEDHDGEGDVAGDDDDDDDDSPDPESPDDSESDS
  ESEKEESAEELQAAEHPDEVEDPKNKKDAKSNYKMMFVKSSGS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055082
• RefSeq Size: 3980
• RefSeq ORF: 549
• Synonyms: IMAGE145052; SMAP
• Locus ID: 10944
• UniProt ID: O00193
• Cytogenetics: 11p15.2