PEN2 (PSENEN) (NM_172341) Human Mass Spec Standard
CAT#: PH303272
PSENEN MS Standard C13 and N15-labeled recombinant protein (NP_758844)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203272 |
Predicted MW | 12 kDa |
Protein Sequence |
>RC203272 protein sequence
Red=Cloning site Green=Tags(s) MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRSAVGFLFWVIV LTSWITIFQIYRPRWGALGDYLSFTIPLGTP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_758844 |
RefSeq Size | 834 |
RefSeq ORF | 303 |
Synonyms | ACNINV2; MDS033; MSTP064; PEN-2; PEN2 |
Locus ID | 55851 |
UniProt ID | Q9NZ42 |
Cytogenetics | 19q13.12 |
Summary | Presenilins, which are components of the gamma-secretase protein complex, are required for intramembranous processing of some type I transmembrane proteins, such as the Notch proteins and the beta-amyloid precursor protein. Signaling by Notch receptors mediates a wide range of developmental cell fates. Processing of the beta-amyloid precursor protein generates neurotoxic amyloid beta peptides, the major component of senile plaques associated with Alzheimer's disease. This gene encodes a protein that is required for Notch pathway signaling, and for the activity and accumulation of gamma-secretase. Mutations resulting in haploinsufficiency for this gene cause familial acne inversa-2 (ACNINV2). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Alzheimer's disease, Notch signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403539 | PSENEN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY403539 | Transient overexpression lysate of presenilin enhancer 2 homolog (C. elegans) (PSENEN) |
USD 436.00 |
|
TP303272 | Recombinant protein of human presenilin enhancer 2 homolog (C. elegans) (PSENEN), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review