AKR1B10 (NM_020299) Human Mass Spec Standard
CAT#: PH303177
AKR1B10 MS Standard C13 and N15-labeled recombinant protein (NP_064695)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203177 |
Predicted MW | 36 kDa |
Protein Sequence |
>RC203177 protein sequence
Red=Cloning site Green=Tags(s) MATFVELSTKAKMPIVGLGTWKSPLGKVKEAVKVAIDAGYRHIDCAYVYQNEHEVGEAIQEKIQEKAVKR EDLFIVSKLWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGDDLFPKDDKGNAIGGKATFLD AWEAMEELVDEGLVKALGVSNFSHFQIEKLLNKPGLKYKPVTNQVECHPYLTQEKLIQYCHSKGITVTAY SPLGSPDRPWAKPEDPSLLEDPKIKEIAAKHKKTAAQVLIRFHIQRNVIVIPKSVTPARIVENIQVFDFK LSDEEMATILSFNRNWRACNVLQSSHLEDYPFDAEY myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_064695 |
RefSeq Size | 1610 |
RefSeq ORF | 948 |
Synonyms | AKR1B11; AKR1B12; ALDRLn; ARL-1; ARL1; HIS; HSI |
Locus ID | 57016 |
UniProt ID | O60218 |
Cytogenetics | 7q33 |
Summary | This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Butanoate metabolism, Fructose and mannose metabolism, Linoleic acid metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402772 | AKR1B10 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY402772 | Transient overexpression lysate of aldo-keto reductase family 1, member B10 (aldose reductase) (AKR1B10) |
USD 436.00 |
|
TP303177 | Recombinant protein of human aldo-keto reductase family 1, member B10 (aldose reductase) (AKR1B10), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review