SR1 (SRI) (NM_003130) Human Mass Spec Standard

SKU
PH303130
SRI MS Standard C13 and N15-labeled recombinant protein (NP_003121)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203130]
Predicted MW 21.7 kDa
Protein Sequence
Protein Sequence
>RC203130 protein sequence
Red=Cloning site Green=Tags(s)

MAYPGHPGAGGGYYPGGYGGAPGGPAFPGQTQDPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYKPF
NLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQA
VNSIAKRYSTNGKITFDDYIACCVKLRALTDSFRRRDTAQQGVVNFPYDDFIQCVMSV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Reference Data
RefSeq NP_003121
RefSeq Size 2036
RefSeq ORF 594
Synonyms CP-22; CP22; SCN; V19
Locus ID 6717
UniProt ID P30626
Cytogenetics 7q21.12
Summary This gene encodes a calcium-binding protein with multiple E-F hand domains that relocates from the cytoplasm to the sarcoplasmic reticulum in response to elevated calcium levels. In addition to regulating intracellular calcium homeostasis it also modulates excitation-contraction coupling in the heart. Alternative splicing results in multiple transcript variants encoding distinct proteins. Multiple pseudogenes exist for this gene. [provided by RefSeq, Mar 2012]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:SR1 (SRI) (NM_003130) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH322838 SRI MS Standard C13 and N15-labeled recombinant protein (NP_944490) 10 ug
$3,255.00
LC401087 SRI HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC403696 SRI HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401087 Transient overexpression lysate of sorcin (SRI), transcript variant 1 100 ug
$436.00
LY403696 Transient overexpression lysate of sorcin (SRI), transcript variant 2 100 ug
$436.00
TP303130 Recombinant protein of human sorcin (SRI), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP322838 Recombinant protein of human sorcin (SRI), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.