Cpn10 (HSPE1) (NM_002157) Human Mass Spec Standard

SKU PH302891

HSPE1 MS Standard C13 and N15-labeled recombinant protein (NP_002148)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC202891]
• Predicted MW: 10.9 kDa
• Protein Sequence:
  Protein Sequence

  >RC202891 protein sequence; Red=Cloning site Green=Tags(s); ; MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDK; VLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_002148
• RefSeq Size: 965
• RefSeq ORF: 306
• Synonyms: CPN10; EPF; GROES; HSP10
• Locus ID: 3336
• UniProt ID: P61604
• Cytogenetics: 2q33.1
• Summary: This gene encodes a major heat shock protein which functions as a chaperonin. Its structure consists of a heptameric ring which binds to another heat shock protein in order to form a symmetric, functional heterodimer which enhances protein folding in an ATP-dependent manner. This gene and its co-chaperonin, HSPD1, are arranged in a head-to-head orientation on chromosome 2. Naturally occurring read-through transcription occurs between this locus and the neighboring locus MOBKL3.[provided by RefSeq, Feb 2011]
• Protein Families: Druggable Genome, Stem cell - Pluripotency