Creatine kinase M type (CKM) (NM_001824) Human Mass Spec Standard

SKU
PH302721
CKM MS Standard C13 and N15-labeled recombinant protein (NP_001815)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202721]
Predicted MW 43.1 kDa
Protein Sequence
Protein Sequence
>RC202721 protein sequence
Red=Cloning site Green=Tags(s)

MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIM
TVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGY
TLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARD
WPDARGIWHNDNKSLLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYV
LTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQV
QLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001815
RefSeq Size 1666
RefSeq ORF 1143
Synonyms CKMM; CPK-M; M-CK
Locus ID 1158
UniProt ID P06732
Cytogenetics 19q13.32
Summary The protein encoded by this gene is a cytoplasmic enzyme involved in energy homeostasis and is an important serum marker for myocardial infarction. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in striated muscle as well as in other tissues, and as a heterodimer with a similar brain isozyme in heart. The encoded protein is a member of the ATP:guanido phosphotransferase protein family. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Protein Pathways Arginine and proline metabolism, Metabolic pathways
Write Your Own Review
You're reviewing:Creatine kinase M type (CKM) (NM_001824) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400690 CKM HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400690 Transient overexpression lysate of creatine kinase, muscle (CKM) 100 ug
$436.00
TP302721 Recombinant protein of human creatine kinase, muscle (CKM), 20 µg 20 ug
$867.00
TP721121 Purified recombinant protein of Human creatine kinase, muscle (CKM) 10 ug
$245.00
TP750145 Purified recombinant heterodimer protein of Human CKMB(full length creatine kinase, muscle (CKM) with N-terminal GST tag, and full length creatine kinase, brain (CKB), with N-terminal His(CKB) tag), expressed in E.coli, 100ug 100 ug
$362.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.