Creatine kinase M type (CKM) (NM_001824) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC202721] |
Predicted MW | 43.1 kDa |
Protein Sequence |
Protein Sequence
>RC202721 protein sequence
Red=Cloning site Green=Tags(s) MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIM TVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGY TLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARD WPDARGIWHNDNKSLLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYV LTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQV QLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001815 |
RefSeq Size | 1666 |
RefSeq ORF | 1143 |
Synonyms | CKMM; CPK-M; M-CK |
Locus ID | 1158 |
UniProt ID | P06732 |
Cytogenetics | 19q13.32 |
Summary | The protein encoded by this gene is a cytoplasmic enzyme involved in energy homeostasis and is an important serum marker for myocardial infarction. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in striated muscle as well as in other tissues, and as a heterodimer with a similar brain isozyme in heart. The encoded protein is a member of the ATP:guanido phosphotransferase protein family. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Arginine and proline metabolism, Metabolic pathways |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC400690 | CKM HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY400690 | Transient overexpression lysate of creatine kinase, muscle (CKM) | 100 ug |
$436.00
|
|
TP302721 | Recombinant protein of human creatine kinase, muscle (CKM), 20 µg | 20 ug |
$867.00
|
|
TP721121 | Purified recombinant protein of Human creatine kinase, muscle (CKM) | 10 ug |
$245.00
|
|
TP750145 | Purified recombinant heterodimer protein of Human CKMB(full length creatine kinase, muscle (CKM) with N-terminal GST tag, and full length creatine kinase, brain (CKB), with N-terminal His(CKB) tag), expressed in E.coli, 100ug | 100 ug |
$362.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.