MAP3K12 binding inhibitory protein 1 (MBIP) (NM_016586) Human Mass Spec Standard

SKU
PH302668
MBIP MS Standard C13 and N15-labeled recombinant protein (NP_057670)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202668]
Predicted MW 39.3 kDa
Protein Sequence
Protein Sequence
>RC202668 protein sequence
Red=Cloning site Green=Tags(s)

MAAATEHNRPSSGDRNLERRCSPNLSREVLYEIFRSLHTLVGQLDLRDDVVKITIDWNKLQSLSAFQPAL
LFSALEQHILYLQPFLAKLQSPIKEENTTAVEEIGRTEMGNKNEVNDKFSIGDLQEEEKHKESDLRDVKK
TQIHFDPEVVQIKAGKAEIDRRISAFIERKQAEINENNVREFCNVIDCNQENSCARTDAIFTPYPGFKSH
VKVSRVVYTYGPQTRPEGIPGSGHKPNSMLRDCGNQAVEERLQNIEAHLRLQTGGPVPRDIYQRIKKLED
KILELEGISPEYFQSVSFSGKRRKVQPPQQNYSLAELDEKISALKQALLRKSREAESMATHHLP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057670
RefSeq Size 1661
RefSeq ORF 1032
Locus ID 51562
UniProt ID Q9NS73
Cytogenetics 14q13.3
Summary Inhibits the MAP3K12 activity to induce the activation of the JNK/SAPK pathway. Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:MAP3K12 binding inhibitory protein 1 (MBIP) (NM_016586) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC413886 MBIP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428551 MBIP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413886 Transient overexpression lysate of MAP3K12 binding inhibitory protein 1 (MBIP), transcript variant 1 100 ug
$436.00
LY428551 Transient overexpression lysate of MAP3K12 binding inhibitory protein 1 (MBIP), transcript variant 2 100 ug
$436.00
TP302668 Recombinant protein of human MAP3K12 binding inhibitory protein 1 (MBIP), transcript variant 1, 20 µg 20 ug
$737.00
TP720564 Recombinant protein of human MAP3K12 binding inhibitory protein 1 (MBIP), transcript variant 2 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.