PAG608 (ZMAT3) (NM_022470) Human Mass Spec Standard

SKU
PH302508
ZMAT3 MS Standard C13 and N15-labeled recombinant protein (NP_071915)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202508]
Predicted MW 32.1 kDa
Protein Sequence
Protein Sequence
>RC202508 protein sequence
Red=Cloning site Green=Tags(s)

MILLQHAVLPPPKQPSPSPPMSVATRSTGTLQLPPQKPFGQEASLPLAGEEELSKGGEQDCALEELCKPL
YCKLCNVTLNSAQQAQAHYQGKNHGKKLRNYYAANSCPPPARMSNVVEPAATPVVPVPPQMGSFKPGGRV
ILATENDYCKLCDASFSSPAVAQAHYQGKNHAKRLRLAEAQSNSFSESSELGQRRARKEGNEFKMMPNRR
NMYTVQNNSAGPYFNPRSRQRIPRDLAMCVTPSGQFYCSMCNVGAGEEMEFRQHLESKQHKSKVSEQRYR
NEMENLGYV

TRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_071915
RefSeq Size 8995
RefSeq ORF 867
Synonyms PAG608; WIG-1; WIG1
Locus ID 64393
UniProt ID Q9HA38
Cytogenetics 3q26.32
Summary This gene encodes a protein containing three zinc finger domains and a nuclear localization signal. The mRNA and the protein of this gene are upregulated by wildtype p53 and overexpression of this gene inhibits tumor cell growth, suggesting that this gene may have a role in the p53-dependent growth regulatory pathway. Alternative splicing of this gene results in two transcript variants encoding two isoforms differing in only one amino acid. [provided by RefSeq, Jul 2008]
Protein Families Transcription Factors
Protein Pathways p53 signaling pathway
Write Your Own Review
You're reviewing:PAG608 (ZMAT3) (NM_022470) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC403457 ZMAT3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC411657 ZMAT3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403457 Transient overexpression lysate of zinc finger, matrin type 3 (ZMAT3), transcript variant 2 100 ug
$436.00
LY411657 Transient overexpression lysate of zinc finger, matrin type 3 (ZMAT3), transcript variant 1 100 ug
$436.00
TP302508 Recombinant protein of human zinc finger, matrin type 3 (ZMAT3), transcript variant 1, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.