Prostaglandin E Synthase (PTGES) (NM_004878) Human Mass Spec Standard

CAT#: PH302405

PTGES MS Standard C13 and N15-labeled recombinant protein (NP_004869)

Product Images

Coomassie blue staining of purified PTGES protein (Cat# TP302405). The protein was produced from HEK293T cells transfected with PTGES cDNA clone (Cat# RC202405) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202405
• Predicted MW: 17.1 kDa
• Protein Sequence:
  Sequence Link

  >RC202405 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLR
  AHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASM
  ALQILWEAARHL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004869
• RefSeq Size: 1787
• RefSeq ORF: 456
• Synonyms: MGST-IV; MGST1-L1; MGST1L1; MPGES; mPGES-1; PGES; PIG12; PP102; PP1294; TP53I12
• Locus ID: 9536
• UniProt ID: O14684
• Cytogenetics: 9q34.11
• Summary: The protein encoded by this gene is a glutathione-dependent prostaglandin E synthase. The expression of this gene has been shown to be induced by proinflammatory cytokine interleukin 1 beta (IL1B). Its expression can also be induced by tumor suppressor protein TP53, and may be involved in TP53 induced apoptosis. Knockout studies in mice suggest that this gene may contribute to the pathogenesis of collagen-induced arthritis and mediate acute pain during inflammatory responses. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Arachidonic acid metabolism, Metabolic pathways