Fatty Acid Binding Protein 5 (FABP5) (NM_001444) Human Mass Spec Standard

CAT#: PH301973

FABP5 MS Standard C13 and N15-labeled recombinant protein (NP_001435)

Product Images

Coomassie blue staining of purified FABP5 protein (Cat# TP301973). The protein was produced from HEK293T cells transfected with FABP5 cDNA clone (Cat# RC201973) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201973
• Predicted MW: 15.2 kDa
• Protein Sequence:
  Sequence Link

  >RC201973 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLG
  EKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001435
• RefSeq Size: 751
• RefSeq ORF: 405
• Synonyms: E-FABP; EFABP; KFABP; PA-FABP; PAFABP
• Locus ID: 2171
• UniProt ID: Q01469, E7DVW5
• Cytogenetics: 8q21.13
• Summary: This gene encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated in psoriasis tissue. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs may play roles in fatty acid uptake, transport, and metabolism. Polymorphisms in this gene are associated with type 2 diabetes. The human genome contains many pseudogenes similar to this locus.[provided by RefSeq, Feb 2011]
• Protein Pathways: PPAR signaling pathway