Tapasin Related Protein (TAPBPL) (NM_018009) Human Mass Spec Standard

CAT#: PH301899

TAPBPL MS Standard C13 and N15-labeled recombinant protein (NP_060479)

Product Images

Coomassie blue staining of purified TAPBPL protein (Cat# TP301899). The protein was produced from HEK293T cells transfected with TAPBPL cDNA clone (Cat# RC201899) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201899
• Predicted MW: 50.2 kDa
• Protein Sequence:
  Sequence Link

  >RC201899 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGTQEGWCLLLCLALSGAAETKPHPAEGQWRAVDVVLDCFLVKDGAHRGALASSEDRARASLVLKQVPVL
  DDGSLEDFTDFQGGTLAQDDPPIIFEASVDLVQIPQAEALLHADCSGKEVTCEISRYFLQMTETTVKTAA
  WFMANVQVSGGGPSISLVMKTPRVAKNEVLWHPTLNLPLSPQGTVRTAVEFQVMTQTQSLSFLLGSSASL
  DCGFSMAPGLDLISVEWRLQHKGRGQLVYSWTAGQGQAVRKGATLEPAQLGMARDASLTLPGLTIQDEGT
  YICQITTSLYRAQQIIQLNIQASPKVRLSLANEALLPTLICDIAGYYPLDVVVTWTREELGGSPAQVSGA
  SFSSLRQSVAGTYSISSSLTAEPGSAGATYTCQVTHISLEEPLGASTQVVPPERRTALGVIFASSLFLLA
  LMFLGLQRRQAPTGLGLLQAERWETTSCADTQSSHLHEDRTARVSQPS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_060479
• RefSeq Size: 1834
• RefSeq ORF: 1404
• Synonyms: TAPBP-R; TAPBPR
• Locus ID: 55080
• UniProt ID: Q9BX59
• Cytogenetics: 12p13.31
• Summary: Tapasin, or TAPBP (MIM 601962), is a member of the variable-constant Ig superfamily that links major histocompatibility complex (MHC) class I molecules to the transporter associated with antigen processing (TAP; see MIM 170260) in the endoplasmic reticulum (ER). The TAPBP gene is located near the MHC complex on chromosome 6p21.3. TAPBPL is a member of the Ig superfamily that is localized on chromosome 12p13.3, a region somewhat paralogous to the MHC.[supplied by OMIM, Mar 2008]
• Protein Families: Druggable Genome, Transmembrane