AHA1 (AHSA1) (NM_012111) Human Mass Spec Standard
CAT#: PH301782
AHSA1 MS Standard C13 and N15-labeled recombinant protein (NP_036243)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201782 |
Predicted MW | 38.3 kDa |
Protein Sequence |
>RC201782 protein sequence
Red=Cloning site Green=Tags(s) MAKWGEGDPRWIVEERADATNVNNWHWTERDASNWSTDKLKTLFLAVQVQNEEGKCEVTEVSKLDGEASI NNRKGKLIFFYEWSVKLNWTGTSKSGVQYKGHVEIPNLSDENSVDEVEISVSLAKDEPDTNLVALMKEEG VKLLREAMGIYISTLKTEFTQGMILPTMNGESVDPVGQPALKTEERKAKPAPSKTQARPVGVKIPTCKIT LKETFLTSPEELYRVFTTQELVQAFTHAPATLEADRGGKFHMVDGNVSGEFTDLVPEKHIVMKWRFKSWP EGHFATITLTFIDKNGETELCMEGRGIPAPEEERTRQGWQRYYFEGIKQTFGYGARLF myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_036243 |
RefSeq Size | 1429 |
RefSeq ORF | 1014 |
Synonyms | AHA1; C14orf3; hAha1; p38 |
Locus ID | 10598 |
UniProt ID | O95433 |
Cytogenetics | 14q24.3 |
Summary | Acts as a co-chaperone of HSP90AA1 (PubMed:29127155). Activates the ATPase activity of HSP90AA1 leading to increase in its chaperone activity (PubMed:29127155). Competes with the inhibitory co-chaperone FNIP1 for binding to HSP90AA1, thereby providing a reciprocal regulatory mechanism for chaperoning of client proteins (PubMed:27353360). Competes with the inhibitory co-chaperone TSC1 for binding to HSP90AA1, thereby providing a reciprocal regulatory mechanism for chaperoning of client proteins (PubMed:29127155).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402150 | AHSA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY402150 | Transient overexpression lysate of AHA1, activator of heat shock 90kDa protein ATPase homolog 1 (yeast) (AHSA1) |
USD 436.00 |
|
TP301782 | Recombinant protein of human AHA1, activator of heat shock 90kDa protein ATPase homolog 1 (yeast) (AHSA1), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review