NUCKS1 (NM_022731) Human Mass Spec Standard

SKU
PH301704
NUCKS1 MS Standard C13 and N15-labeled recombinant protein (NP_073568)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201704]
Predicted MW 27.3 kDa
Protein Sequence
Protein Sequence
>RC201704 protein sequence
Red=Cloning site Green=Tags(s)

MSRPVRNRKVVDYSQFQESDDADEDYGRDSGPPTKKIRSSPREAKNKRRSGKNSQEDSEDSEDKDVKTKK
DDSHSAEDSEDEKEDHKNVRQQRQAASKAASKQREMLMEDVGSEEEQEEEDEAPFQEKDSGSDEDFLMED
DDDSDYGSSKKKNKKMVKKSKPERKEKKMPKPRLKATVTPSPVKGKGKVGRPTASKASKEKTPSPKEEDE
EPESPPEKKTSTSPPPEKSGDEGSEDEAPSGED

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_073568
RefSeq Size 6471
RefSeq ORF 729
Synonyms JC7; NUCKS
Locus ID 64710
UniProt ID Q9H1E3
Cytogenetics 1q32.1
Summary This gene encodes a nuclear protein that is highly conserved in vertebrates. The conserved regions of the protein contain several consensus phosphorylation sites for casein kinase II and cyclin-dependent kinases, two putative nuclear localization signals, and a basic DNA-binding domain. It is phosphorylated in vivo by Cdk1 during mitosis of the cell cycle. [provided by RefSeq, Aug 2010]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:NUCKS1 (NM_022731) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC411597 NUCKS1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411597 Transient overexpression lysate of nuclear casein kinase and cyclin-dependent kinase substrate 1 (NUCKS1) 100 ug
$436.00
TP301704 Recombinant protein of human nuclear casein kinase and cyclin-dependent kinase substrate 1 (NUCKS1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.