PCMF (KCMF1) (NM_020122) Human Mass Spec Standard

CAT#: PH301679

KCMF1 MS Standard C13 and N15-labeled recombinant protein (NP_064507)

Product Images

Coomassie blue staining of purified KCMF1 protein (Cat# TP301679). The protein was produced from HEK293T cells transfected with KCMF1 cDNA clone (Cat# RC201679) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201679
• Predicted MW: 41.9 kDa
• Protein Sequence:
  Sequence Link

  >RC201679 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSRHEGVSCDACLKGNFRGRRYKCLICYDYDLCASCYESGATTTRHTTDHPMQCILTRVDFDLYYGGEAF
  SVEQPQSFTCPYCGKMGYTETSLQEHVTSEHAETSTEVICPICAALPGGDPNHVTDDFAAHLTLEHRAPR
  DLDESSGVRHVRRMFHPGRGLGGPRARRSNMHFTSSSTGGLSSSQSSYSPSNREAMDPIAELLSQLSGVR
  RSAGGQLNSSGPSASQLQQLQMQLQLERQHAQAARQQLETARNATRRTNTSSVTTTITQSTATTNIANTE
  SSQQTLQNSQFLLTRLNDPKMSETERQSMESERADRSLFVQELLLSTLVREESSSSDEDDRGEMADFGAM
  GCVDIMPLDVALENLNLKESNKGNEPPPPPL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_064507
• RefSeq Size: 7555
• RefSeq ORF: 1143
• Synonyms: DEBT91; FIGC; PCMF; ZZZ1
• Locus ID: 56888
• UniProt ID: Q9P0J7
• Cytogenetics: 2p11.2
• Summary: Has intrinsic E3 ubiquitin ligase activity and promotes ubiquitination.[UniProtKB/Swiss-Prot Function]