CYB5R3 (NM_000398) Human Mass Spec Standard
CAT#: PH301592
CYB5R3 MS Standard C13 and N15-labeled recombinant protein (NP_000389)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201592 |
Predicted MW | 34.2 kDa |
Protein Sequence |
>RC201592 protein sequence
Red=Cloning site Green=Tags(s) MGAQLSTLGHMVLFPVWFLYSLLMKLFQRSTPAITLESPDIKYPLRLIDREIISHDTRRFRFALPSPQHI LGLPVGQHIYLSARIDGNLVVRPYTPISSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESMQIGDTI EFRGPSGLLVYQGKGKFAIRPDKKSNPIIRTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFAN QTEKDILLRPELEELRNKHSARFKLWYTLDRAPEAWDYGQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMI QYACLPNLDHVGHPTERCFVF myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_000389 |
RefSeq Size | 2923 |
RefSeq ORF | 903 |
Synonyms | B5R; DIA1 |
Locus ID | 1727 |
UniProt ID | P00387 |
Cytogenetics | 22q13.2 |
Summary | This gene encodes cytochrome b5 reductase, which includes a membrane-bound form in somatic cells (anchored in the endoplasmic reticulum, mitochondrial and other membranes) and a soluble form in erythrocytes. The membrane-bound form exists mainly on the cytoplasmic side of the endoplasmic reticulum and functions in desaturation and elongation of fatty acids, in cholesterol biosynthesis, and in drug metabolism. The erythrocyte form is located in a soluble fraction of circulating erythrocytes and is involved in methemoglobin reduction. The membrane-bound form has both membrane-binding and catalytic domains, while the soluble form has only the catalytic domain. Alternate splicing results in multiple transcript variants. Mutations in this gene cause methemoglobinemias. [provided by RefSeq, Jan 2010] |
Protein Families | Druggable Genome |
Protein Pathways | Amino sugar and nucleotide sugar metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400140 | CYB5R3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC416053 | CYB5R3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC432902 | CYB5R3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY400140 | Transient overexpression lysate of cytochrome b5 reductase 3 (CYB5R3), transcript variant 1 |
USD 436.00 |
|
LY416053 | Transient overexpression lysate of cytochrome b5 reductase 3 (CYB5R3), transcript variant 2 |
USD 436.00 |
|
LY432902 | Transient overexpression lysate of cytochrome b5 reductase 3 (CYB5R3), transcript variant 5 |
USD 436.00 |
|
PH317552 | CYB5R3 MS Standard C13 and N15-labeled recombinant protein (NP_015565) |
USD 3,255.00 |
|
TP301592 | Recombinant protein of human cytochrome b5 reductase 3 (CYB5R3), transcript variant 1, 20 µg |
USD 867.00 |
|
TP317552 | Recombinant protein of human cytochrome b5 reductase 3 (CYB5R3), transcript variant 2, 20 µg |
USD 867.00 |
|
TP329902 | Purified recombinant protein of Homo sapiens cytochrome b5 reductase 3 (CYB5R3), transcript variant 5, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review