CRALBP (RLBP1) (NM_000326) Human Mass Spec Standard

SKU
PH301136
RLBP1 MS Standard C13 and N15-labeled recombinant protein (NP_000317)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201136]
Predicted MW 36.5 kDa
Protein Sequence
Protein Sequence
>RC201136 protein sequence
Red=Cloning site Green=Tags(s)

MSEGVGTFRMVPEEEQELRAQLEQLTTKDHGPVFGPCSQLPRHTLQKAKDELNEREETREEAVRELQEMV
QAQAASGEELAVAVAERVQEKDSGFFLRFIRARKFNVGRAYELLRGYVNFRLQYPELFDSLSPEAVRCTI
EAGYPGVLSSRDKYGRVVMLFNIENWQSQEITFDEILQAYCFILEKLLENEETQINGFCIIENFKGFTMQ
QAASLRTSDLRKMVDMLQDSFPARFKAIHFIHQPWYFTTTYNVVKPFLKSKLLERVFVHGDDLSGFYQEI
DENILPSDFGGTLPKYDGKAVAEQLFGPQAQAENTAF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000317
RefSeq Size 1752
RefSeq ORF 951
Synonyms CRALBP
Locus ID 6017
UniProt ID P12271
Cytogenetics 15q26.1
Summary The protein encoded by this gene is a 36-kD water-soluble protein which carries 11-cis-retinaldehyde or 11-cis-retinal as physiologic ligands. It may be a functional component of the visual cycle. Mutations of this gene have been associated with severe rod-cone dystrophy, Bothnia dystrophy (nonsyndromic autosomal recessive retinitis pigmentosa) and retinitis punctata albescens. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:CRALBP (RLBP1) (NM_000326) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC424794 RLBP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY424794 Transient overexpression lysate of retinaldehyde binding protein 1 (RLBP1) 100 ug
$436.00
TP301136 Recombinant protein of human retinaldehyde binding protein 1 (RLBP1), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.