PDXK (NM_003681) Human Mass Spec Standard
CAT#: PH300975
PDXK MS Standard C13 and N15-labeled recombinant protein (NP_003672)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200975 |
Predicted MW | 35.1 kDa |
Protein Sequence |
>RC200975 protein sequence
Red=Cloning site Green=Tags(s) MEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLR LNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKV VPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNP AGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGE GVRPSPMQLELRMVQSKRDIEDPEIVVQATVL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_003672 |
RefSeq Size | 7390 |
RefSeq ORF | 936 |
Synonyms | C21orf97; C21orf124; HEL-S-1a; HMSN6C; PKH; PNK; PRED79 |
Locus ID | 8566 |
UniProt ID | O00764, V9HWC3 |
Cytogenetics | 21q22.3 |
Summary | The protein encoded by this gene phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. The encoded protein is cytoplasmic and probably acts as a homodimer. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Vitamin B6 metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418499 | PDXK HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY418499 | Transient overexpression lysate of pyridoxal (pyridoxine, vitamin B6) kinase (PDXK) |
USD 436.00 |
|
TP300975 | Recombinant protein of human pyridoxal (pyridoxine, vitamin B6) kinase (PDXK), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review