DDA1 (NM_024050) Human Mass Spec Standard

SKU PH300826

DDA1 MS Standard C13 and N15-labeled recombinant protein (NP_076955)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC200826]
• Predicted MW: 11.8 kDa
• Protein Sequence:
  Protein Sequence

  >RC200826 protein sequence; Red=Cloning site Green=Tags(s); ; MADFLKGLPVYNKSNFSRFHADSVCKASNRRPSVYLPTREYPSEQIIVTEKTNILLRYLHQQWDKKNAAK; KRDQEQVELEGESSAPPRKVARTDSPDMHEDT; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_076955
• RefSeq Size: 4078
• RefSeq ORF: 306
• Synonyms: C19orf58; PCIA1
• Locus ID: 79016
• UniProt ID: Q9BW61
• Cytogenetics: 19p13.11
• Summary: May be involved in ubiquitination and subsequent proteasomal degradation of target proteins. Component of the DDD-E2 complexes which may provide a platform for interaction with CUL4A and WD repeat proteins.[UniProtKB/Swiss-Prot Function]