OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CUEDC2 (NM_024040) Human Mass Spec Standard

Be the first to review this product
SKU
PH300790
CUEDC2 MS Standard C13 and N15-labeled recombinant protein (NP_076945)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA800815 CUEDC2 mouse monoclonal antibody,clone OTI2H6
100 ul
$447.00
LY411416 Transient overexpression lysate of CUE domain containing 2 (CUEDC2) (as WB positive control)
100 ug
$436.00

Other products for "CUEDC2 or NM_024040"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200790
Predicted MW 24.7 kDa
Protein Sequence
Protein Sequence
>RC200790 protein sequence
Red=Cloning site Green=Tags(s)

MELERIVSAALLAFVQTHLPEADLSGLDEVIFSYVLGVLEDLGPSGPSEENFDMEAFTEMMEAYVPGFAH
IPRGTIGDMMQKLSGQLSDARNKENLQPQSSGVQGQVPISPEPLQRPEMLKEETRSSAAAAADTQDEATG
AEEELLPGVDVLLEVFPTCSVEQAQWVLAKARGDLEEAVQMLVEGKEEGPAAWEGPNQDLPRRLRGPQKD
ELKSFILQKYMMVDSA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_076945
RefSeq Size 1203
RefSeq ORF 678
Synonyms bA18I14.5; C10orf66
Locus ID 79004
UniProt ID Q9H467
Cytogenetics 10q24.32
Summary Down-regulates ESR1 protein levels through the ubiquitination-proteasome pathway, regardless of the presence of 17 beta-estradiol. Also involved in 17 beta-estradiol-induced ESR1 degradation. Controls PGR protein levels through a similar mechanism.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CUEDC2" proteins (3)
SKU Description Size Price
LC411416 Lyophilized CUEDC2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411416 Transient overexpression lysate of CUE domain containing 2 (CUEDC2) (as WB positive control) 100 ug
$436.00
TP300790 Recombinant protein of human CUE domain containing 2 (CUEDC2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products