KPC2 (UBAC1) (NM_016172) Human Mass Spec Standard

CAT#: PH300734

UBAC1 MS Standard C13 and N15-labeled recombinant protein (NP_057256)

Product Images

Coomassie blue staining of purified UBAC1 protein (Cat# TP300734). The protein was produced from HEK293T cells transfected with UBAC1 cDNA clone (Cat# RC200734) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200734
• Predicted MW: 45.3 kDa
• Protein Sequence:
  Sequence Link

  >RC200734 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MFVQEEKIFAGKVLRLHICASDGAEWLEEATEDTSVEKLKERCLKHCAHGSLEDPKSITHHKLIHAASER
  VLSDARTILEENIQDQDVLLLIKKRAPSPLPKMADVSAEEKKKQDQKAPDKEAILRATANLPSYNMDRAA
  VQTNMRDFQTELRKILVSLIEVAQKLLALNPDAVELFKKANAMLDEDEDERVDEAALRQLTEMGFPENRA
  TKALQLNHMSVPQAMEWLIEHAEDPTIDTPLPGQAPPEAEGATAAASEAAAGASATDEEARDELTEIFKK
  IRRKREFRADARAVISLMEMGFDEKEVIDALRVNNNQQNAACEWLLGDRKPSPEELDKGIDPDSPLFQAI
  LDNPVVQLGLTNPKTLLAFEDMLENPLNSTQWMNDPETGPVMLQISRIFQTLNRT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057256
• RefSeq Size: 1877
• RefSeq ORF: 1215
• Synonyms: GBDR1; KPC2; UBADC1
• Locus ID: 10422
• UniProt ID: Q9BSL1, A0A140VK64
• Cytogenetics: 9q34.3
• Summary: Non-catalytic subunit of the KPC complex that acts as E3 ubiquitin-protein ligase. Required for poly-ubiquitination and proteasome-mediated degradation of CDKN1B during G1 phase of the cell cycle.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome