BAD (NM_004322) Human Mass Spec Standard

SKU PH300634

BAD MS Standard C13 and N15-labeled recombinant protein (NP_004313)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC200634]
• Predicted MW: 18.2 kDa
• Protein Sequence:
  Protein Sequence

  >RC200634 representing NM_004322; Red=Cloning site Green=Tags(s); ; MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIR; SRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQ; MRQSSSWTRVFQSWWDRNLGRGSSAPSQ; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_004313
• RefSeq Size: 1127
• RefSeq ORF: 504
• Synonyms: BBC2; BCL2L8
• Locus ID: 572
• UniProt ID: Q92934
• Cytogenetics: 11q13.1
• Summary: The protein encoded by this gene is a member of the BCL-2 family. BCL-2 family members are known to be regulators of programmed cell death. This protein positively regulates cell apoptosis by forming heterodimers with BCL-xL (B-cell lymphoma-extra large) and BCL-2, and reversing their death repressor activity. Proapoptotic activity of this protein is regulated through its phosphorylation. Protein kinases AKT and MAP kinase, as well as protein phosphatase calcineurin were found to be involved in the regulation of this protein. Alternative splicing of this gene results in two transcript variants which encode the same isoform. [provided by RefSeq, Dec 2019]
• Protein Families: Druggable Genome
• Protein Pathways: Acute myeloid leukemia, Alzheimer's disease, Amyotrophic lateral sclerosis (ALS), Apoptosis, Chronic myeloid leukemia, Colorectal cancer, Endometrial cancer, ErbB signaling pathway, Focal adhesion, Insulin signaling pathway, Melanoma, Neurotrophin signaling pathway, Non-small cell lung cancer, Pancreatic cancer, Pathways in cancer, Prostate cancer, VEGF signaling pathway