RON(MST1R) (NM_002447) Human Mutant ORF Clone

CAT#: RC402619

MST1R Mutant (K621X), Myc-DDK-tagged ORF clone of Homo sapiens macrophage stimulating 1 receptor (c-met-related tyrosine kinase) (MST1R) as transfection-ready DNA

Change vector?

  • TrueORF®

USD 989


Availability*
2 Weeks

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name RON(MST1R) (NM_002447) Human Mutant ORF Clone
Mutation Description K621X
Affected Codon# 621
Affected NT# 1861
Nucleotide Mutation MST1R Mutant (K621X), Myc-DDK-tagged ORF clone of Homo sapiens macrophage stimulating 1 receptor (c-met-related tyrosine kinase) (MST1R) as transfection-ready DNA
Effect Poenil proein defiieny
Symbol MST1R
Synonyms CD136; CDw136; PTK8; RON
Vector pCMV6-Entry
Tag Myc-DDK
ACCN NM_002447
ORF Size 4203 bp
Sequence Data
ORF Nucleotide Sequence
>RC402619 representing NM_002447
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCTCCTCCCGCCGCTGCCTCAGTCCTTCCTGTTGCTGCTGCTGTTGCCTGCCAAGCCCGCGGCGG
GCGAGGACTGGCAGTGCCCGCGCACCCCCTACGCGGCCTCTCGCGACTTTGACGTGAAGTACGTGGTGCC
CAGCTTCTCCGCCGGAGGCCTGGTACAGGCCATGGTGACCTACGAGGGCGACAGAAATGAGAGTGCTGTG
TTTGTAGCCATACGCAATCGCCTGCATGTGCTTGGGCCTGACCTGAAGTCTGTCCAGAGCCTGGCCACGG
GCCCTGCTGGAGACCCTGGCTGCCAGACGTGTGCAGCCTGTGGCCCAGGACCCCACGGCCCTCCCGGTGA
CACAGACACAAAGGTGCTGGTGCTGGATCCCGCGCTGCCTGCGCTGGTCAGTTGTGGCTCCAGCCTGCAG
GGCCGCTGCTTCCTGCATGACCTAGAGCCCCAAGGGACAGCCGTGCATCTGGCAGCGCCAGCCTGCCTCT
TCTCAGCCCACCATAACCGGCCCGATGACTGCCCCGACTGTGTGGCCAGCCCATTGGGCACCCGTGTAAC
TGTGGTTGAGCAAGGCCAGGCCTCCTATTTCTACGTGGCATCCTCACTGGACGCAGCCGTGGCTGCCAGC
TTCAGCCCACGCTCAGTGTCTATCAGGCGTCTCAAGGCTGACGCCTCGGGATTCGCACCGGGCTTTGTGG
CGTTGTCAGTGCTGCCCAAGCATCTTGTCTCCTACAGTATTGAATACGTGCACAGCTTCCACACGGGAGC
CTTCGTATACTTCCTGACTGTACAGCCGGCCAGCGTGACAGATGATCCTAGTGCCCTGCACACACGCCTG
GCACGGCTTAGCGCCACTGAGCCAGAGTTGGGTGACTATCGGGAGCTGGTCCTCGACTGCAGATTTGCTC
CAAAACGCAGGCGCCGGGGGGCCCCAGAAGGCGGACAGCCCTACCCTGTGCTGCGGGTGGCCCACTCCGC
TCCAGTGGGTGCCCAACTTGCCACTGAGCTGAGCATCGCCGAGGGCCAGGAAGTACTATTTGGGGTCTTT
GTGACTGGCAAGGATGGTGGTCCTGGCGTGGGCCCCAACTCTGTCGTCTGTGCCTTCCCCATTGACCTGC
TGGACACACTAATTGATGAGGGTGTGGAGCGCTGTTGTGAATCCCCAGTCCATCCAGGCCTCCGGCGAGG
CCTCGACTTCTTCCAGTCGCCCAGTTTTTGCCCCAACCCGCCTGGCCTGGAAGCCCTCAGCCCCAACACC
AGCTGCCGCCACTTCCCTCTGCTGGTCAGTAGCAGCTTCTCACGTGTGGACCTATTCAATGGGCTGTTGG
GACCAGTACAGGTCACTGCATTGTATGTGACACGCCTTGACAACGTCACAGTGGCACACATGGGCACAAT
GGATGGGCGTATCCTGCAGGTGGAGCTGGTCAGGTCACTAAACTACTTGCTGTATGTGTCCAACTTCTCA
CTGGGTGACAGTGGGCAGCCCGTGCAGCGGGATGTCAGTCGTCTTGGGGACCACCTACTCTTTGCCTCTG
GGGACCAGGTTTTCCAGGTACCTATCCAAGGCCCTGGCTGCCGCCACTTCCTGACCTGTGGGCGTTGCCT
AAGGGCATGGCATTTCATGGGCTGTGGCTGGTGTGGGAACATGTGCGGCCAGCAGAAGGAGTGTCCTGGC
TCCTGGCAACAGGACCACTGCCCACCTAAGCTTACTGAGTTCCACCCCCACAGTGGACCTCTAAGGGGCA
GTACAAGGCTGACCCTGTGTGGCTCCAACTTCTACCTTCACCCTTCTGGTCTGGTGCCTGAGGGAACCCA
TCAGGTCACTGTGGGCCAAAGTCCCTGCCGGCCACTGCCC


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGA TAAG
GTTTAA
Protein Sequence
>RC402619 representing NM_002447
Red=Cloning site Green=Tags(s)

MELLPPLPQSFLLLLLLPAKPAAGEDWQCPRTPYAASRDFDVKYVVPSFSAGGLVQAMVTYEGDRNESAV
FVAIRNRLHVLGPDLKSVQSLATGPAGDPGCQTCAACGPGPHGPPGDTDTKVLVLDPALPALVSCGSSLQ
GRCFLHDLEPQGTAVHLAAPACLFSAHHNRPDDCPDCVASPLGTRVTVVEQGQASYFYVASSLDAAVAAS
FSPRSVSIRRLKADASGFAPGFVALSVLPKHLVSYSIEYVHSFHTGAFVYFLTVQPASVTDDPSALHTRL
ARLSATEPELGDYRELVLDCRFAPKRRRRGAPEGGQPYPVLRVAHSAPVGAQLATELSIAEGQEVLFGVF
VTGKDGGPGVGPNSVVCAFPIDLLDTLIDEGVERCCESPVHPGLRRGLDFFQSPSFCPNPPGLEALSPNT
SCRHFPLLVSSSFSRVDLFNGLLGPVQVTALYVTRLDNVTVAHMGTMDGRILQVELVRSLNYLLYVSNFS
LGDSGQPVQRDVSRLGDHLLFASGDQVFQVPIQGPGCRHFLTCGRCLRAWHFMGCGWCGNMCGQQKECPG
SWQQDHCPPKLTEFHPHSGPLRGSTRLTLCGSNFYLHPSGLVPEGTHQVTVGQSPCRPLP

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-MluI      Cloning Scheme for this gene     
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NP_002438
RefSeq Size 1860
RefSeq ORF 4203
Locus ID 4486
Cytogenetics 3p21.31
Protein Families Protein Kinase, ES Cell Differentiation/IPS, Transmembrane, Druggable Genome
MW 68.2 kDa
Gene Summary This gene encodes a cell surface receptor for macrophage-stimulating protein (MSP) with tyrosine kinase activity. The mature form of this protein is a heterodimer of disulfide-linked alpha and beta subunits, generated by proteolytic cleavage of a single-chain precursor. The beta subunit undergoes tyrosine phosphorylation upon stimulation by MSP. This protein is expressed on the ciliated epithelia of the mucociliary transport apparatus of the lung, and together with MSP, thought to be involved in host defense. Alternative splicing generates multiple transcript variants encoding different isoforms that may undergo similar proteolytic processing. [provided by RefSeq, Jan 2016]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.