BTK (NM_000061) Human Mutant ORF Clone

CAT#: RC400772

  • TrueORF®

BTK Mutant (Q15X), Myc-DDK-tagged ORF clone of Homo sapiens Bruton agammaglobulinemia tyrosine kinase (BTK) as transfection-ready DNA


Reconstitution Protocol

USD 225.00

2 Weeks*

Size
    • 10 ug

Product Images

Specifications

Product Data
Mutation Description Q15X
Affected Codon# 15
Affected NT# 43
Tag Myc-DDK
Effect Ammlobulinemi
Symbol BTK
Synonyms AGMX1; AT; ATK; BPK; IGHD3; IMD1; PSCTK1; XLA
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Vector pCMV6-Entry
ACCN NM_000061
ORF Size 42 bp
Sequence Data
>RC400772 representing NM_000061
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGCAGTGATTCTGGAGAGCATCTTTCTGAAGCGATCC

AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGA TAAG
GTTTAA
>RC400772 representing NM_000061
Red=Cloning site Green=Tags(s)

MAAVILESIFLKRS

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-MluI      Cloning Scheme for this gene     
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reference Data
RefSeq NP_000052
RefSeq Size 42 bp
RefSeq ORF 1980 bp
Locus ID 695
Cytogenetics Xq22.1
Domains pkinase, SH2, TyrKc, SH3, BTK, PH, S_TKc
Protein Families Druggable Genome, Protein Kinase
Protein Pathways B cell receptor signaling pathway, Fc epsilon RI signaling pathway, Primary immunodeficiency
MW 1.5 kDa
Gene Summary The protein encoded by this gene plays a crucial role in B-cell development. Mutations in this gene cause X-linked agammaglobulinemia type 1, which is an immunodeficiency characterized by the failure to produce mature B lymphocytes, and associated with a failure of Ig heavy chain rearrangement. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2013]

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.