IDH2 (NM_002168) Human Mutant ORF Clone

CAT#: RC400103

IDH2 mutant (R172K), Myc-DDK-tagged ORF clone of Homo sapiens isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2), nuclear gene encoding mitochondrial protein as transfection-ready DNA

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 721.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name IDH2 (NM_002168) Human Mutant ORF Clone
Mutation Description R172K
Affected Codon# 172
Affected NT# c. 515
Nucleotide Mutation IDH2 mutant (R172K), Myc-DDK-tagged ORF clone of Homo sapiens isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2), nuclear gene encoding mitochondrial protein as transfection-ready DNA
Effect missense
Symbol IDH2
Synonyms D2HGA2; ICD-M; IDH; IDHM; IDP; IDPM; mNADP-IDH
Vector pCMV6-Entry
Tag Myc-DDK
ACCN NM_002168
ORF Size 1359 bp
Sequence Data
>RC400103 representing NM_002168
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGGCTACCTGCGGGTCGTGCGCTCGCTCTGCAGAGCCTCAGGCTCGCGGCCGGCCTGGGCGCCGG
CGGCCCTGACAGCCCCCACCTCGCAAGAGCAGCCGCGGCGCCACTATGCCGACAAAAGGATCAAGGTGGC
GAAGCCCGTGGTGGAGATGGATGGTGATGAGATGACCCGTATTATCTGGCAGTTCATCAAGGAGAAGCTC
ATCCTGCCCCACGTGGACATCCAGCTAAAGTATTTTGACCTCGGGCTCCCAAACCGTGACCAGACTGATG
ACCAGGTCACCATTGACTCTGCACTGGCCACCCAGAAGTACAGTGTGGCTGTCAAGTGTGCCACCATCAC
CCCTGATGAGGCCCGTGTGGAAGAGTTCAAGCTGAAGAAGATGTGGAAAAGTCCCAATGGAACTATCCGG
AACATCCTGGGGGGGACTGTCTTCCGGGAGCCCATCATCTGCAAAAACATCCCACGCCTAGTCCCTGGCT
GGACCAAGCCCATCACCATTGGCAAGCACGCCCATGGCGACCAGTACAAGGCCACAGACTTTGTGGCAGA
CCGGGCCGGCACTTTCAAAATGGTCTTCACCCCAAAAGATGGCAGTGGTGTCAAGGAGTGGGAAGTGTAC
AACTTCCCCGCAGGCGGCGTGGGCATGGGCATGTACAACACCGACGAGTCCATCTCAGGTTTTGCGCACA
GCTGCTTCCAGTATGCCATCCAGAAGAAATGGCCGCTGTACATGAGCACCAAGAACACCATACTGAAAGC
CTACGATGGGCGTTTCAAGGACATCTTCCAGGAGATCTTTGACAAGCACTATAAGACCGACTTCGACAAG
AATAAGATCTGGTATGAGCACCGGCTCATTGATGACATGGTGGCTCAGGTCCTCAAGTCTTCGGGTGGCT
TTGTGTGGGCCTGCAAGAACTATGACGGAGATGTGCAGTCAGACATCCTGGCCCAGGGCTTTGGCTCCCT
TGGCCTGATGACGTCCGTCCTGGTCTGCCCTGATGGGAAGACGATTGAGGCTGAGGCCGCTCATGGGACC
GTCACCCGCCACTATCGGGAGCACCAGAAGGGCCGGCCCACCAGCACCAACCCCATCGCCAGCATCTTTG
CCTGGACACGTGGCCTGGAGCACCGGGGGAAGCTGGATGGGAACCAAGACCTCATCAGGTTTGCCCAGAT
GCTGGAGAAGGTGTGCGTGGAGACGGTGGAGAGTGGAGCCATGACCAAGGACCTGGCGGGCTGCATTCAC
GGCCTCAGCAATGTGAAGCTGAACGAGCACTTCCTGAACACCACGGACTTCCTCGACACCATCAAGAGCA
ACCTGGACAGAGCCCTGGGCAGGCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC400103 representing NM_002168
Red=Cloning site Green=Tags(s)

MAGYLRVVRSLCRASGSRPAWAPAALTAPTSQEQPRRHYADKRIKVAKPVVEMDGDEMTRIIWQFIKEKL
ILPHVDIQLKYFDLGLPNRDQTDDQVTIDSALATQKYSVAVKCATITPDEARVEEFKLKKMWKSPNGTIR
NILGGTVFREPIICKNIPRLVPGWTKPITIGKHAHGDQYKATDFVADRAGTFKMVFTPKDGSGVKEWEVY
NFPAGGVGMGMYNTDESISGFAHSCFQYAIQKKWPLYMSTKNTILKAYDGRFKDIFQEIFDKHYKTDFDK
NKIWYEHRLIDDMVAQVLKSSGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGT
VTRHYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIH
GLSNVKLNEHFLNTTDFLDTIKSNLDRALGRQ

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene     
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NP_002159
RefSeq Size 1740
RefSeq ORF 1359
Locus ID 3418
Cytogenetics 15q26.1
Domains isodh
Protein Pathways Citrate cycle (TCA cycle), Glutathione metabolism, Metabolic pathways
MW 46.6 kDa
Gene Summary Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the mitochondria. It plays a role in intermediary metabolism and energy production. This protein may tightly associate or interact with the pyruvate dehydrogenase complex. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2014].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)