E7 (NC_001526) Virus Tagged ORF Clone

CAT#: VC101903

Myc-DDK-tagged ORF clone of viral ORF for transforming protein [Human papillomavirus type 16], codon optimized for human cell expression, NP_041326

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 390.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name E7 (NC_001526) Virus Tagged ORF Clone
Symbol E7
Vector pCMV6-Entry
Sequence Data
>The Viral ORF clone VC101903 represents NCBI reference of NP_041326 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s)

GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCACGGCGACACCCCCACTCTTCACGAATATATGCTGGATCTGCAGCCAGAAACAACCGATCTTTACT
GCTATGAACAGCTGAATGACTCATCAGAAGAAGAGGACGAGATCGATGGCCCAGCGGGCCAAGCCGAGCC
AGATCGCGCTCATTACAATATTGTGACTTTCTGTTGCAAGTGTGATTCAACACTGCGCCTGTGTGTGCAA
TCCACTCACGTAGATATTAGAACATTGGAGGACCTGCTCATGGGCACACTGGGAATCGTGTGTCCCATCT
GTTCCCAAAAGCCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>VC101903 representing NP_041326
Red=Cloning sites Green=Tags

MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQ
STHVDIRTLEDLLMGTLGIVCPICSQKP

TRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-MluI      Cloning Scheme for this gene     
Tag Myc-DDK
ACCN NC_001526
ORF Size 294 bp
OTI Disclaimer The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decuded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NC_001526.2, NP_041326
RefSeq ORF 294
Locus ID 1489079
MW 11.0 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)