BDLF3.5 (NC_007605) Virus Tagged ORF Clone

CAT#: VC101185

Reviews ()
Write a review
  • TrueORF®

Myc-DDK-tagged ORF clone of viral ORF for BDLF35 [Human herpesvirus 4], codon optimized for human cell expression, YP_401725



  View other clones from "Virus" (71)

USD 400.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name BDLF3.5 (NC_007605) Virus Tagged ORF Clone
Type Virus Tagged ORF Clone
Tag Myc-DDK
Symbol BDLF3.5
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>The Viral ORF clone VC101185 represents NCBI reference of YP_401725 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s)

GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCAGCCCCCGGATGCAGTGAACGCCAGGACAAGAAAAGGGGCACGATCGGCGAGAGAGAGTTCGGCG
AGCTTCTGTCTTGGGACCCAACAGATCTCCCTCGGACTGTGGCTAGAGTGTACGTGGCAGTCGGTGGACT
TTTCGAGCAGGAAGTCAGTGAAGTGCAGCGACTCGAAAACATATGTACCCTTCTTGACCTGGCCGGCGTA
GAATGTCAGACAAAAGCGGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>VC101185 representing YP_401725
Red=Cloning sites Green=Tags

MSAPGCSERQDKKRGTIGEREFGELLSWDPTDLPRTVARVYVAVGGLFEQEVSEVQRLENICTLLDLAGV
ECQTKAD

TRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-MluI      Cloning Scheme for this gene     
Tag Myc-DDK
ACCN NC_007605
ORF Size 231 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decuded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NC_007605.1, YP_401725
RefSeq ORF 231 bp
Locus ID 3783769
MW 8.5 kDa

Citations (1)

Other Versions

Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools