BDLF3.5 (NC_007605) Virus Tagged ORF Clone

CAT#: VC101185

Myc-DDK-tagged ORF clone of viral ORF for BDLF35 [Human herpesvirus 4], codon optimized for human cell expression, YP_401725

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

USD 390.00


Availability*
In Stock

Size
    • 10 ug

Cited in 2 publications.

Product images

Specifications

Product Data
Product Name BDLF3.5 (NC_007605) Virus Tagged ORF Clone
Symbol BDLF3.5
Vector pCMV6-Entry
Sequence Data
>The Viral ORF clone VC101185 represents NCBI reference of YP_401725 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s)

GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCAGCCCCCGGATGCAGTGAACGCCAGGACAAGAAAAGGGGCACGATCGGCGAGAGAGAGTTCGGCG
AGCTTCTGTCTTGGGACCCAACAGATCTCCCTCGGACTGTGGCTAGAGTGTACGTGGCAGTCGGTGGACT
TTTCGAGCAGGAAGTCAGTGAAGTGCAGCGACTCGAAAACATATGTACCCTTCTTGACCTGGCCGGCGTA
GAATGTCAGACAAAAGCGGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>VC101185 representing YP_401725
Red=Cloning sites Green=Tags

MSAPGCSERQDKKRGTIGEREFGELLSWDPTDLPRTVARVYVAVGGLFEQEVSEVQRLENICTLLDLAGV
ECQTKAD

TRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-MluI      Cloning Scheme for this gene     
Tag Myc-DDK
ACCN NC_007605
ORF Size 231 bp
OTI Disclaimer The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decuded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NC_007605.1, YP_401725
RefSeq ORF 231
Locus ID 3783769
MW 8.5 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)