BDLF4 (NC_009334) Virus Tagged ORF Clone

CAT#: VC101065

Myc-DDK-tagged ORF clone of viral ORF for BDLF4 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129488

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 390.00


Availability*
3 Weeks

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name BDLF4 (NC_009334) Virus Tagged ORF Clone
Symbol BDLF4
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>The Viral ORF clone VC101065 represents NCBI reference of YP_001129488 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s)

GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTGACCAGGGCCGCCTGTCTCTGCCCCGCGGCGAGGGTGGTACCGACGAACCTAATCCACGCCATT
TGTGCAGCTACAGTAAACTGGAGTTCCACCTGCCTCTGCCTGAAAGTATGGCCTCAGTCTTTGCCTGCTG
GGGTTGTGGCGAGTACCATGTGTGCGACGGAAGCAGCGAATGCACACTTATTGAGACGCATGAGGGGGTG
GTGTGCGCGCTCACCGGGAACTATATGGGACCACACTTCCAGCCCGCGCTCAGGCCATGGACTGAAATCA
GGCAAGATACGCAGGATCAGAGAGATAAGTGGGAACCAGAACAGGTTCAAGGGCTCGTCAAAACCGTGGT
GAACCACTTGTACCACTATTTTCTGAACGAGAACGTGATTTCCGGCGTGAGCGAGGCGCTGTTCGATCAG
GAGGGCGCGCTGAGGCCCCACATACCGGCACTGGTTTCCTTCGTGTTCCCCTGCTGTCTGATGCTCTTCC
GAGGAGCATCAAGCGAGAAGGTCGTCGACGTGGTCCTCTCCCTGTATATTCATGTGATTATAAGCATCTA
CAGCCAGAAAACAGTCTATGGCGCTCTTCTTTTTAAGTCCACAAGGAATAAACGCTACGACGCCGTCGCT
AAGCGGATGCGCGAGCTCTGGATGTCTACTCTGACTACAAAGTGT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>VC101065 representing YP_001129488
Red=Cloning sites Green=Tags

MSDQGRLSLPRGEGGTDEPNPRHLCSYSKLEFHLPLPESMASVFACWGCGEYHVCDGSSECTLIETHEGV
VCALTGNYMGPHFQPALRPWTEIRQDTQDQRDKWEPEQVQGLVKTVVNHLYHYFLNENVISGVSEALFDQ
EGALRPHIPALVSFVFPCCLMLFRGASSEKVVDVVLSLYIHVIISIYSQKTVYGALLFKSTRNKRYDAVA
KRMRELWMSTLTTKC

TRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-MluI      Cloning Scheme for this gene     
Tag Myc-DDK
ACCN NC_009334
ORF Size 675 bp
OTI Disclaimer The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decuded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NC_009334.1, YP_001129488
RefSeq ORF 675
Locus ID 5176193
MW 25.4 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)