BGLF3 (NC_009334) Virus Tagged ORF Clone

CAT#: VC101064

Myc-DDK-tagged ORF clone of viral ORF for BGLF3 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129484

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 390.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name BGLF3 (NC_009334) Virus Tagged ORF Clone
Symbol BGLF3
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>The Viral ORF clone VC101064 represents NCBI reference of YP_001129484 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s)

GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTCAACGCCGTCAAAGCAGACATGCCAGATGACCCGATGCTTGCAAGGCGGTACGGTCAATGTCTGG
AGTTGGCTCTGGAGGCATGTCAGGACACACCTGAACAGTTTAAGCTCGTGGAGACGCCCCTGAAGTCCTT
TCTGCTGGTATCCAACATACTGCCACAGGATAACCGCCCCTGGCACGAAGCCCGCAGCTCCGGCCGCGTT
GCCGAAGACGACTATGATTTTTCCTCTCTGGCACTTGAATTGCTGCCACTGAATCCCCGCCTGCCTGAGG
AATGGCAGTTTGGGGGCCAGGGTTGGTCTAGTCGAATGGAACCATCCCAGCCCGAGATGGGCATGGGTCT
TTGCTTTGAAGTTTTTGATGGCGATTTGATGCGGATCGCCCTGGCGTGGAACAAGGATGAAGTGATCGGA
CAGGCGCTCCAGATTCTCGCGCACAGCCATACATGGACAAGCCTGGTACCTGAGGATCCTTTGCCTTGGA
TGTGGGCTCTGTTCTATGGCCCCAGATCCCATTGCGAAGAGCGCCATTGTGTCTATGCAGCAGCCAGAGG
CAAGCGAGGCCCCATCCTGCTTCCAACAGCCGTCTATACCCCCTGTGCTAACATAGAAGCTTTCCTTGCC
CACCTGACAAGATGCGTTTACGCACTCTATCTGGATGTGCGAGATTGGAAAGGGGAGGATATCGCCCCAC
CCTTTGATGTCAGCCGCCTGAATAAGATGGCTAAACAGTTGTGCCTGCTTCCACAGGAGCCCTTTTGCAT
CACTAGGGTGTGCCTTCTCTGTCTGCTGCATAAGCAGAACCTTAATGCCCAGTACAAGAGGCCAGTTGAC
ACATATGACCCCTGCTTGATCCTCACCGGCGAGGCAGAGAGGTATATGGTAGATGCTGTTGGAAACTATC
GCGAGGCAAGTACAGGGACCACAGTCCTGTACCCTACATATGATCTCGGATCAATTGTCGCGGACATGGT
AACTTACGAAGACGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>VC101064 representing YP_001129484
Red=Cloning sites Green=Tags

MFNAVKADMPDDPMLARRYGQCLELALEACQDTPEQFKLVETPLKSFLLVSNILPQDNRPWHEARSSGRV
AEDDYDFSSLALELLPLNPRLPEEWQFGGQGWSSRMEPSQPEMGMGLCFEVFDGDLMRIALAWNKDEVIG
QALQILAHSHTWTSLVPEDPLPWMWALFYGPRSHCEERHCVYAAARGKRGPILLPTAVYTPCANIEAFLA
HLTRCVYALYLDVRDWKGEDIAPPFDVSRLNKMAKQLCLLPQEPFCITRVCLLCLLHKQNLNAQYKRPVD
TYDPCLILTGEAERYMVDAVGNYREASTGTTVLYPTYDLGSIVADMVTYEDE

TRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-MluI      Cloning Scheme for this gene     
Tag Myc-DDK
ACCN NC_009334
ORF Size 996 bp
OTI Disclaimer The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decuded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NC_009334.1, YP_001129484
RefSeq ORF 996
Locus ID 5176188
MW 37.7 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)