BGLF3 (NC_009334) Virus Tagged ORF Clone

CAT#: VC101064

Reviews ()
Write a review
  • TrueORF®

Myc-DDK-tagged ORF clone of viral ORF for BGLF3 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129484



  View other clones from "Virus" (71)

USD 400.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name BGLF3 (NC_009334) Virus Tagged ORF Clone
Type Virus Tagged ORF Clone
Tag Myc-DDK
Symbol BGLF3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>The Viral ORF clone VC101064 represents NCBI reference of YP_001129484 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s)

GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTCAACGCCGTCAAAGCAGACATGCCAGATGACCCGATGCTTGCAAGGCGGTACGGTCAATGTCTGG
AGTTGGCTCTGGAGGCATGTCAGGACACACCTGAACAGTTTAAGCTCGTGGAGACGCCCCTGAAGTCCTT
TCTGCTGGTATCCAACATACTGCCACAGGATAACCGCCCCTGGCACGAAGCCCGCAGCTCCGGCCGCGTT
GCCGAAGACGACTATGATTTTTCCTCTCTGGCACTTGAATTGCTGCCACTGAATCCCCGCCTGCCTGAGG
AATGGCAGTTTGGGGGCCAGGGTTGGTCTAGTCGAATGGAACCATCCCAGCCCGAGATGGGCATGGGTCT
TTGCTTTGAAGTTTTTGATGGCGATTTGATGCGGATCGCCCTGGCGTGGAACAAGGATGAAGTGATCGGA
CAGGCGCTCCAGATTCTCGCGCACAGCCATACATGGACAAGCCTGGTACCTGAGGATCCTTTGCCTTGGA
TGTGGGCTCTGTTCTATGGCCCCAGATCCCATTGCGAAGAGCGCCATTGTGTCTATGCAGCAGCCAGAGG
CAAGCGAGGCCCCATCCTGCTTCCAACAGCCGTCTATACCCCCTGTGCTAACATAGAAGCTTTCCTTGCC
CACCTGACAAGATGCGTTTACGCACTCTATCTGGATGTGCGAGATTGGAAAGGGGAGGATATCGCCCCAC
CCTTTGATGTCAGCCGCCTGAATAAGATGGCTAAACAGTTGTGCCTGCTTCCACAGGAGCCCTTTTGCAT
CACTAGGGTGTGCCTTCTCTGTCTGCTGCATAAGCAGAACCTTAATGCCCAGTACAAGAGGCCAGTTGAC
ACATATGACCCCTGCTTGATCCTCACCGGCGAGGCAGAGAGGTATATGGTAGATGCTGTTGGAAACTATC
GCGAGGCAAGTACAGGGACCACAGTCCTGTACCCTACATATGATCTCGGATCAATTGTCGCGGACATGGT
AACTTACGAAGACGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>VC101064 representing YP_001129484
Red=Cloning sites Green=Tags

MFNAVKADMPDDPMLARRYGQCLELALEACQDTPEQFKLVETPLKSFLLVSNILPQDNRPWHEARSSGRV
AEDDYDFSSLALELLPLNPRLPEEWQFGGQGWSSRMEPSQPEMGMGLCFEVFDGDLMRIALAWNKDEVIG
QALQILAHSHTWTSLVPEDPLPWMWALFYGPRSHCEERHCVYAAARGKRGPILLPTAVYTPCANIEAFLA
HLTRCVYALYLDVRDWKGEDIAPPFDVSRLNKMAKQLCLLPQEPFCITRVCLLCLLHKQNLNAQYKRPVD
TYDPCLILTGEAERYMVDAVGNYREASTGTTVLYPTYDLGSIVADMVTYEDE

TRTRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene     
Tag Myc-DDK
ACCN NC_009334
ORF Size 996 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decuded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NC_009334.1, YP_001129484
RefSeq ORF 996 bp
Locus ID 5176188
MW 37.7 kDa

Citations (1)

Other Versions

Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools